PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10001421m
Common NameCARUB_v10001421mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family M-type_MADS
Protein Properties Length: 330aa    MW: 37304.2 Da    PI: 8.9023
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10001421mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF31.62.1e-1096135443
                      -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
           SRF-TF   4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43 
                      e k +r v  skRr++++ KA  L+ L +a+vav + s+ 
  Carubv10001421m  96 ETKQQRAVACSKRRQTVFSKAADLCLLSGANVAVFVTSPA 135
                      77999*******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006612.85385133IPR002100Transcription factor, MADS-box
SMARTSM004322.9E-1885144IPR002100Transcription factor, MADS-box
CDDcd002662.97E-2286165No hitNo description
SuperFamilySSF554554.45E-1687172IPR002100Transcription factor, MADS-box
PfamPF003192.6E-996143IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MNVNKKGKYT HKLCHKKENI NFDQKKKRKI ITRSTDHYNI YALLCFYSVF TSVFGSPLFI  60
SRLCKQKKNT MQSSSSVSES TTKKGTKRKI EIKKRETKQQ RAVACSKRRQ TVFSKAADLC  120
LLSGANVAVF VTSPAESSDV VYSFSGYSPA HEIADCYLNR KPPPKFVVNP QSKLGFWWED  180
PDLYKSCDDL SELNMIEDRI ERMKKHVMAC LEKKEKSQCV SNSEQNPSSS VHECFNDQTL  240
ASSFHGDRNP NFSTQSSSQV GSFCQNPYSS LDKICGESSS QVASPYPNLN SEIQGCDETE  300
DETNLIMNLP HPQATQPRRI GMYLHESIH*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10001421m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023637356.10.0agamous-like MADS-box protein AGL97
TrEMBLR0HBN40.0R0HBN4_9BRAS; Uncharacterized protein
STRINGXP_006288185.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63951442
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G27130.13e-94AGAMOUS-like 39