PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10001114m
Common NameCARUB_v10001114mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family M-type_MADS
Protein Properties Length: 402aa    MW: 46669.7 Da    PI: 4.762
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10001114mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF44.71.7e-14948342
                     --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
           SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                     i +++ r++tf kR++g++KK +EL +LC+++++ +i+s+
  Carubv10001114m  9 IADERSRKTTFMKRKKGMIKKLHELTTLCGVQACGVIYSP 48
                     78999*********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.3E-17158IPR002100Transcription factor, MADS-box
PRINTSPR004044.8E-6121IPR002100Transcription factor, MADS-box
PROSITE profilePS5006614.703147IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.49E-19293IPR002100Transcription factor, MADS-box
CDDcd002668.96E-27283No hitNo description
PfamPF003194.3E-15948IPR002100Transcription factor, MADS-box
PRINTSPR004044.8E-62136IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MRKLKLSLIA DERSRKTTFM KRKKGMIKKL HELTTLCGVQ ACGVIYSPYL PAPEVWPSKE  60
GVEEVVTKFM EMPMAAKTKK MMNQDTYLRE QITKTKEQVE KLTSENRDLE VKQFMFDCLE  120
GKMLEYRYGA KDLHDLHCYI NYYIEQLTRR MKILEENGES SSFPPLSVGA ADLDPLAIAD  180
FPVNVNASAI SVASEFFDHI QYQNMNMNQN LQEPVQNLQE PVQNLQESVQ YLQEPVQYLQ  240
EPVQYQQEPV QYLQESVQYL HEPVQYLHEP VQYLQEPVQY QQEPVQYQAF PDRNGHIQEE  300
VYNNMTWNPN MNLDLSHNLN LNLDLNLSQY LNQENSFKDM MVEQNVGYAG GYARIPFIDG  360
NHSNYHQQPT VDLDITNHMP FITSSTTSTL GAYASYNNSY M*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11429RKTTFMKRKKGMIKKL
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10001114m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006286512.10.0agamous-like MADS-box protein AGL36
TrEMBLR0H4000.0R0H400_9BRAS; Uncharacterized protein
STRINGXP_006286512.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26650.13e-79AGAMOUS-like 36