PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10001050m
Common NameCARUB_v10001050mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 421aa    MW: 46070.8 Da    PI: 5.192
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10001050mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.83.2e-15222276357
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                      ++k+ rr+ +NRe+ArrsR+RK++++  Le+ v  L++e ++L k+l++++ +++
  Carubv10001050m 222 DVKKSRRMLSNRESARRSRRRKQEQTSDLETQVNDLKGEHSSLLKQLSNMNHKYD 276
                      789*****************************************99999888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.6E-20220284IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.116222277IPR004827Basic-leucine zipper domain
PfamPF001702.2E-14222276IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.14E-12223275No hitNo description
Gene3DG3DSA:1.20.5.1708.4E-13224275No hitNo description
PROSITE patternPS000360227242IPR004827Basic-leucine zipper domain
PfamPF124985.6E-13291354IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002240Biological Processresponse to molecule of oomycetes origin
GO:0009626Biological Processplant-type hypersensitive response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000693Biological Processpositive regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 421 aa     Download sequence    Send to blast
MNSIFSIDDF SDPFWETPPI PLNPDSAKNP TSAEVSQSQP EWTFEMFLEE ISISSSAVSS  60
EPLGNNNAIV GVSSAQSLPS VSGQNDFEDD SRFRDRDSGN WDCAAPPPPT TVVVDSDDYR  120
RVLKNKLETE CATVVALRVG SVKPEDSTSS PETQLQPAQS NPLTQGSLVA PGKIGVTSSL  180
PAELKKSGVP MKQVTSGSSR DYSDDDDLDE ENETTGSLNP EDVKKSRRML SNRESARRSR  240
RRKQEQTSDL ETQVNDLKGE HSSLLKQLSN MNHKYDEAAV GNRILKADIE TLRAKVKMAE  300
ETVKRVTGMN PMLLGRSSGH NNNRMPVTGN NRMDSSSNNP AFQPHSNLNH MSNPNVGIPN  360
ILPPRLGNNF VPPPSLNSQA NLPLQRIRNG QNHHVAPNGN TYGWTTEPQN DSAWPKKCVD  420
*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1236243RRSRRRKQ
2238243SRRRKQ
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the C-box-like motif (5'-TGCTGACGTCA-3') and G-box-like motif (5'-CCACGTGGCC-3'), ABRE elements, of gene promoters. Binds to the 5'-ACGT-3' motif of seed storage protein (SSP) encoding gene promoters (e.g. At2S and CRU3) and promotes their expression in seeds when in complex with ABI3 and BZIP53. Involved in the defense responses to the biotrophic pathogen Hyaloperonospora parasitica and oxidative stress responses; mediates positively cell death (PubMed:12657652, PubMed:16957775, PubMed:19261733, PubMed:19531597). Promotes BZIP53-mediated response to hypoosmolarity stress that leads to POX1/PRODH1 accumulation (PubMed:16810321). {ECO:0000269|PubMed:12657652, ECO:0000269|PubMed:16810321, ECO:0000269|PubMed:16957775, ECO:0000269|PubMed:19261733, ECO:0000269|PubMed:19531597}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCarubv10001050m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3102220.0AF310222.1 Arabidopsis thaliana bZIP protein BZO2H1 mRNA, complete cds, alternatively spliced.
GenBankBT0255580.0BT025558.1 Arabidopsis thaliana At4g02640 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006286506.10.0basic leucine zipper 10 isoform X1
SwissprotO227630.0BZP10_ARATH; Basic leucine zipper 10
TrEMBLR0GRA40.0R0GRA4_9BRAS; Uncharacterized protein
STRINGXP_006286506.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM148711720
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02640.20.0bZIP family protein
Publications ? help Back to Top
  1. Pedrotti L, et al.
    Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness.
    Plant Cell, 2018. 30(2): p. 495-509
    [PMID:29348240]