PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_9966_iso_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 77aa    MW: 8881.56 Da    PI: 4.4778
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_9966_iso_3genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.31.1e-102871146
                                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                                        ++ ++++E+ l+ +  ++ G + W++Ia +++ gRt++++  +w++
  cra_locus_9966_iso_3_len_607_ver_3 28 KLHFSEDEEFLITRMYNLVGER-WSLIAGRIP-GRTAEEIEKYWNT 71
                                        5789******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.4942377IPR017930Myb domain
SMARTSM007171.1E-82775IPR001005SANT/Myb domain
SuperFamilySSF466892.42E-93073IPR009057Homeodomain-like
PfamPF002492.4E-93071IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-133172IPR009057Homeodomain-like
CDDcd001676.00E-83171No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 77 aa     Download sequence    Send to blast
MADHLDHSST SNDASADSKA EENSQDNKLH FSEDEEFLIT RMYNLVGERW SLIAGRIPGR  60
TAEEIEKYWN TRYSTSQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011463172.11e-36PREDICTED: transcription factor CPC-like
TrEMBLM5WU463e-35M5WU46_PRUPE; Uncharacterized protein
STRINGPOPTR_0004s02060.15e-31(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA65791932