PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_9787_iso_4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 217aa    MW: 24311.4 Da    PI: 11.2949
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_9787_iso_4genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like993.4e-31148201255
                              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                          pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHL +YR+
  cra_locus_9787_iso_4_len_1761_ver_3 148 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLRMYRT 201
                                          9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.5E-15145201IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.2E-27146201IPR009057Homeodomain-like
TIGRFAMsTIGR015575.7E-22148201IPR006447Myb domain, plants
PfamPF002491.7E-7149200IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MAKSDSNSFE LSLANNPNRV SSNSDHPNIN ISNLIQSTNS SNLIHSFPHP HHQIHHHHLL  60
HHHHQQNNNN NQAGLMSSEL GFLRPIRGIP VYQNHLSSSS LDKLIVPSTT TSNTFSSTTT  120
PAASFPSQNL MRSRILSRFP AKRSMRAPRM RWTTTLHARF VHAVELLGGH ERATPKSVLE  180
LMDVKDLTLA HVKSHLRMYR TVKTTDRAAA SSGNVCY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-16149203458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-16149203458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-16149203458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-16149203458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-16149203458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-16149203458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-16149203458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-16149203458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022756946.14e-72probable transcription factor KAN2 isoform X2
TrEMBLA0A067KUB84e-69A0A067KUB8_JATCU; Uncharacterized protein
TrEMBLB9RZ098e-70B9RZ09_RICCO; Transcription factor, putative
STRINGXP_002518978.11e-70(Ricinus communis)