PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_9787_iso_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 365aa    MW: 40893.2 Da    PI: 8.9971
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_9787_iso_3genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like35.13e-11148171225
                              G2-like   2 prlrWtpeLHerFveaveqLGGse 25 
                                          pr+rWt++LH+rFv+ave LGG+e
  cra_locus_9787_iso_3_len_1765_ver_3 148 PRMRWTTTLHARFVHAVELLGGHE 171
                                          9*********************97 PP

2G2-like45.81.4e-142022322555
                              G2-like  25 ekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                            AtPk++lelm+vk+Ltl+hvkSHL +YR+
  cra_locus_9787_iso_3_len_1765_ver_3 202 SGATPKSVLELMDVKDLTLAHVKSHLRMYRT 232
                                          67****************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.55E-10145172IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-24146172IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-9198232IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.4E-24204232IPR009057Homeodomain-like
SuperFamilySSF466895.55E-10205232IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MAKSDSNSFE LSLANNPNRV SSNSDHPNIN ISNLIQSTNS SNLIHSFPHP HHQIHHHHLL  60
HHHHQQNNNN NQAGLMSSEL GFLRPIRGIP VYQNHLSSSS LDKLIVPSTT TSNTFSSTTT  120
PAASFPSQNL MRSRILSRFP AKRSMRAPRM RWTTTLHARF VHAVELLGGH ESKXASLFLL  180
IFPMEEDNNF IIFWGVNFGN FSGATPKSVL ELMDVKDLTL AHVKSHLRMY RTVKTTDRAA  240
ASSGQSDIYE NGSSGDNSDQ DLMFDVQNSR KSELSVHQGR PNTTTHHQDK DNYHALWTNN  300
SSREAWLHGK TNPDSIGNIQ ISSIEKEIEM KCPSYDRISE VSSSSVSAET SPKKPNLEFT  360
LGRPL
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates lateral organ polarity. Promotes abaxial cell fate during lateral organd formation. Functions with KAN1 in the specification of polarity of the ovule outer integument. {ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:15286295, ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:17307928}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023898660.11e-111probable transcription factor KAN2 isoform X1
SwissprotQ9C6163e-68KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A067KUB81e-105A0A067KUB8_JATCU; Uncharacterized protein
STRINGVIT_02s0012g01940.t011e-105(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27382255
Publications ? help Back to Top
  1. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]