PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_9747_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family EIL
Protein Properties Length: 273aa    MW: 30483.1 Da    PI: 6.0023
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_9747_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3114.81.6e-3535113182
                                          XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                                 EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvY 74 
                                          eel++rmwkd+++lkrlker+k    +++ a++++ks++s++qarrkkmsraQDgiLkYMlk mevc+a+GfvY
  cra_locus_9747_iso_2_len_2393_ver_3  35 EELERRMWKDRVKLKRLKERQKLA--AQQ-AAEKQKSKQSTDQARRKKMSRAQDGILKYMLKLMEVCKARGFVY 105
                                          8*******************9963..354.599***************************************** PP

                                          XXXXXXXX CS
                                 EIN3  75 giipekgk 82 
                                          giipekg 
  cra_locus_9747_iso_2_len_2393_ver_3 106 GIIPEKGS 113
                                          ******96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048737.1E-3235114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042762Biological Processregulation of sulfur metabolic process
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MEEIGVDISS DIEVDDIRCD NIAEKDVSDE EIEAEELERR MWKDRVKLKR LKERQKLAAQ  60
QAAEKQKSKQ STDQARRKKM SRAQDGILKY MLKLMEVCKA RGFVYGIIPE KGSQLHNREP  120
TSLPHYGHGS GFQRRTQHSL LQHNPGSSGL MPGVQNSGLP HLASYNLYHQ PVGFGPARQG  180
EQSGTSVSVL QPRMPSSDFS LPVPEKNGGE VTDGGFSHCF KDTFQNEQHR SVENHLAVPP  240
LEGLSPDFSS SFLDGAAFDD YLLGDDLIEY LAS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00233DAPTransfer from AT1G73730Download
Motif logo