PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_9734_iso_5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 454aa    MW: 49032.5 Da    PI: 6.4654
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_9734_iso_5genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.81e-27171225156
                              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                          k +++WtpeLH+rFv+aveqL G +kA+P++ilelm++++Lt+++++SHLQkYR++
  cra_locus_9734_iso_5_len_1881_ver_3 171 KVKVDWTPELHRRFVQAVEQL-GVDKAVPSRILELMGIDCLTRHNIASHLQKYRSH 225
                                          5689*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.095168227IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.4E-27169228IPR009057Homeodomain-like
SuperFamilySSF466893.76E-18170228IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-26171225IPR006447Myb domain, plants
PfamPF002494.9E-8174223IPR001005SANT/Myb domain
PRINTSPR012171.5E-9268284No hitNo description
PRINTSPR012171.5E-9309321No hitNo description
PRINTSPR012171.5E-9322343No hitNo description
PRINTSPR012171.5E-9348364No hitNo description
PRINTSPR012171.5E-9370387No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007165Biological Processsignal transduction
GO:0009658Biological Processchloroplast organization
GO:0009910Biological Processnegative regulation of flower development
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0010638Biological Processpositive regulation of organelle organization
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 454 aa     Download sequence    Send to blast
MLAVSPLRSN NNERKKEICE ISSSTSFPVV DDFPDFGGAN LLDSIDFDEL FVGINGEDDV  60
LPDLEMDPHD ILAEFSLTES LSPSVSLDHQ HHEHSQITSS ISAADYDKLV ELEDKANSSS  120
ASDDVGSGSS TLTQGEDVVS KSTVLNPSSK EGDKGRKSSS TQSKNSSGKK KVKVDWTPEL  180
HRRFVQAVEQ LGVDKAVPSR ILELMGIDCL TRHNIASHLQ KYRSHRKHLL AREAEAANWS  240
QRRQLYGGTA AAAGGGKRDV NPWLAPTMGF PPPMAPAAVP HFRPLHVWGH PSVDQSLMHV  300
WPKHLAPPPR PPTWPPTPTP TPTPPPPPPD PNSFWHSPHQ RVPNPLTPGT PCFPPPLTPA  360
RFPTPPVPGI PPPPMYKVDP VAGMGVPAPA TGQAVPHAPP LDFHPSTESV DAAIGDVLSK  420
PWLPLPLGLK PPSIDSVLVE LQRQGIPKIP PVCT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-16167223157ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00022PBMTransfer from AT2G20570Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027127047.11e-170transcription activator GLK1-like
TrEMBLV7BXL11e-162V7BXL1_PHAVU; Uncharacterized protein
STRINGXP_007149809.11e-163(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA25322356