PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_9734_iso_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 291aa    MW: 31877 Da    PI: 10.2822
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_9734_iso_3genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.61.1e-271062356
                              G2-like  3 rlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56
                                         +++WtpeLH+rFv+aveqL G +kA+P++ilelm++++Lt+++++SHLQkYR++
  cra_locus_9734_iso_3_len_2047_ver_3 10 KVDWTPELHRRFVQAVEQL-GVDKAVPSRILELMGIDCLTRHNIASHLQKYRSH 62
                                         789****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.236164IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.1E-261065IPR009057Homeodomain-like
TIGRFAMsTIGR015574.1E-261062IPR006447Myb domain, plants
SuperFamilySSF466898.42E-181165IPR009057Homeodomain-like
PfamPF002492.6E-81160IPR001005SANT/Myb domain
PRINTSPR012173.4E-9101117No hitNo description
PRINTSPR012173.4E-9141162No hitNo description
PRINTSPR012173.4E-9162178No hitNo description
PRINTSPR012173.4E-9192209No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007165Biological Processsignal transduction
GO:0009658Biological Processchloroplast organization
GO:0009910Biological Processnegative regulation of flower development
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0010638Biological Processpositive regulation of organelle organization
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MFRLKNFFYK VDWTPELHRR FVQAVEQLGV DKAVPSRILE LMGIDCLTRH NIASHLQKYR  60
SHRKHLLARE AEAANWSQRR QLYGGTAAAA GGGKRDVNPW LAPTMGFPPP MAPAAVPHFR  120
PLHVWGHPSV DQSLMHVWPK HLAPPPRPPT WPPTPTPTPT PPPPPPDPNS FWHSPHQRVP  180
NPLTPGTPCF PPPLTPARFP TPPVPGIPPP PMYKVDPVAG MGVPAPATGQ AVPHAPPLDF  240
HPSTESVDAA IGDVLSKPWL PLPLGLKPPS IDSVLVELQR QGIPKIPPVC T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-151060757ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that functions with GLK2 to promote chloroplast development. Acts as an activator of nuclear photosynthetic genes involved in chlorophyll biosynthesis, light harvesting, and electron transport. Acts in a cell-autonomous manner to coordinate and maintain the photosynthetic apparatus within individual cells. May function in photosynthetic capacity optimization by integrating responses to variable environmental and endogenous cues (PubMed:11828027, PubMed:12220263, PubMed:17533111, PubMed:18643989, PubMed:19376934, PubMed:19383092, PubMed:19726569). Prevents premature senescence (PubMed:23459204). {ECO:0000269|PubMed:11828027, ECO:0000269|PubMed:12220263, ECO:0000269|PubMed:17533111, ECO:0000269|PubMed:18643989, ECO:0000269|PubMed:19376934, ECO:0000269|PubMed:19383092, ECO:0000269|PubMed:19726569, ECO:0000269|PubMed:23459204}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00022PBMTransfer from AT2G20570Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By light. Repressed by BZR2. {ECO:0000269|PubMed:12220263, ECO:0000269|PubMed:21214652}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021279775.11e-129transcription activator GLK1
SwissprotQ9SIV32e-79GLK1_ARATH; Transcription activator GLK1
TrEMBLA0A067EF821e-124A0A067EF82_CITSI; Uncharacterized protein
TrEMBLA0A2H5PT751e-124A0A2H5PT75_CITUN; Uncharacterized protein
STRINGXP_006470159.11e-126(Citrus sinensis)
Publications ? help Back to Top
  1. Leister D,Kleine T
    Definition of a core module for the nuclear retrograde response to altered organellar gene expression identifies GLK overexpressors as gun mutants.
    Physiol Plant, 2016. 157(3): p. 297-309
    [PMID:26876646]
  2. Nagatoshi Y, et al.
    GOLDEN 2-LIKE transcription factors for chloroplast development affect ozone tolerance through the regulation of stomatal movement.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(15): p. 4218-23
    [PMID:27035938]
  3. Tokumaru M, et al.
    Ubiquitin-Proteasome Dependent Regulation of the GOLDEN2-LIKE 1 Transcription Factor in Response to Plastid Signals.
    Plant Physiol., 2017. 173(1): p. 524-535
    [PMID:27821720]
  4. Ni F, et al.
    Turnip Yellow Mosaic Virus P69 Interacts with and Suppresses GLK Transcription Factors to Cause Pale-Green Symptoms in Arabidopsis.
    Mol Plant, 2017. 10(5): p. 764-766
    [PMID:27964999]
  5. Wang H,Seo JK,Gao S,Cui X,Jin H
    Silencing of AtRAP, a target gene of a bacteria-induced small RNA, triggers antibacterial defense responses through activation of LSU2 and down-regulation of GLK1.
    New Phytol., 2017. 215(3): p. 1144-1155
    [PMID:28656601]