PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_94_iso_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 128aa    MW: 14813.7 Da    PI: 10.6961
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_94_iso_3genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding65.78.5e-211459147
                                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                      +g+W++eEdell ++v+++G+++W++I++ ++ gR++k+c++rw + 
  cra_locus_94_iso_3_len_769_ver_3 14 KGPWSPEEDELLQQLVQKHGPRNWSLISKSIQ-GRSGKSCRLRWCNQ 59
                                      79******************************.***********985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.759964IPR017930Myb domain
SuperFamilySSF466895.74E-201186IPR009057Homeodomain-like
SMARTSM007172.0E-171362IPR001005SANT/Myb domain
PfamPF002491.4E-201459IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.4E-231463IPR009057Homeodomain-like
CDDcd001679.28E-161658No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 128 aa     Download sequence    Send to blast
MSSNSMRKDV DRIKGPWSPE EDELLQQLVQ KHGPRNWSLI SKSIQGRSGK SCRLRWCNQL  60
SPQVEXQQQQ QRYLVQQHQQ HVQQQQQQMM MMHNGMGMGM GMGMMQASAA NDGFRNNAIK  120
RIGINKIE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C4e-181380373C-Myb DNA-Binding Domain
1msf_C4e-181380373C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00476DAPTransfer from AT4G37260Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009588514.11e-35PREDICTED: transcription factor MYB44
RefseqXP_016478014.11e-35PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW16e-30MYB44_ARATH; Transcription factor MYB44
TrEMBLA5C1F53e-35A5C1F5_VITVI; Putative uncharacterized protein
TrEMBLQ8H0H06e-35Q8H0H0_TOBAC; Myb-like protein
STRINGVIT_07s0129g01050.t013e-34(Vitis vinifera)