PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_9362_iso_5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 390aa    MW: 42618.2 Da    PI: 7.2632
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_9362_iso_5genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like108.53.6e-34127181155
                              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                          kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQkYRl
  cra_locus_9362_iso_5_len_1396_ver_3 127 KPRLRWTAELHERFVDAVTQLGGPDKATPKTIMRTMGVKGLTLYHLKSHLQKYRL 181
                                          79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.095124184IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.9E-33124182IPR009057Homeodomain-like
SuperFamilySSF466892.87E-17126183IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-24127182IPR006447Myb domain, plants
PfamPF002491.3E-8129180IPR001005SANT/Myb domain
PfamPF143798.2E-26225270IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010628Biological Processpositive regulation of gene expression
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
XSRGVFRLPF LQAHPVPSLP LPLHSPRLWK SLLTLQGRPI SVNSVFLQEF YTFQEKKEQE  60
SLGCCQFQVR KEMYSSARLP IVQTLPLEGA AGTGGGEFHH HQHGPIMSLD GTNLPGDACL  120
VLTTDPKPRL RWTAELHERF VDAVTQLGGP DKATPKTIMR TMGVKGLTLY HLKSHLQKYR  180
LGKQSSKETT ENSKDASCVA ESQDTGSSTS ASSRMIAQDL NDGYQVTEAL RVQMEVQRRL  240
HEQLEVQRRL QLRIEAQSKY LQSILEKACK VLNDQALVSA GLEVAREELS ELAIKVASDC  300
QGVASVPSLT DVAASMENTN ASSMPARIGD CSIESCLTTS NESPVSPLGG GSQAPAAMKK  360
RSRPELGNVE SLPLEGTMPQ VDWVISNIGS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A7e-19127183258Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B7e-19127183258Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A7e-19127183157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B7e-19127183157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C7e-19127183157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D7e-19127183157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A7e-19127183258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C7e-19127183258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D7e-19127183258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F7e-19127183258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H7e-19127183258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J7e-19127183258Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:26586833). Acts redundantly with PHR1 as a key component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). {ECO:0000269|PubMed:26586833}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00378DAPTransfer from AT3G24120Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027120092.11e-178protein PHR1-LIKE 3-like isoform X1
SwissprotQ94A571e-128PHL2_ARATH; Protein PHR1-LIKE 2
TrEMBLA0A068TU041e-177A0A068TU04_COFCA; Uncharacterized protein
STRINGXP_006493809.11e-160(Citrus sinensis)
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]