PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_9362_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 394aa    MW: 43054.8 Da    PI: 7.2632
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_9362_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like108.43.7e-34131185155
                              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                          kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQkYRl
  cra_locus_9362_iso_2_len_1409_ver_3 131 KPRLRWTAELHERFVDAVTQLGGPDKATPKTIMRTMGVKGLTLYHLKSHLQKYRL 185
                                          79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.0E-33128186IPR009057Homeodomain-like
PROSITE profilePS5129413.095128188IPR017930Myb domain
SuperFamilySSF466892.87E-17130187IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-24131186IPR006447Myb domain, plants
PfamPF002491.4E-8133184IPR001005SANT/Myb domain
PfamPF143798.3E-26229274IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010628Biological Processpositive regulation of gene expression
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
XLSLLPRGVF RLPFLQAHPV PSLPLPLHSP RLWKSLLTLQ GRPISVNSVF LQEFYTFQEK  60
KEQESLGCCQ FQVRKEMYSS ARLPIVQTLP LEGAAGTGGG EFHHHQHGPI MSLDGTNLPG  120
DACLVLTTDP KPRLRWTAEL HERFVDAVTQ LGGPDKATPK TIMRTMGVKG LTLYHLKSHL  180
QKYRLGKQSS KETTENSKDA SCVAESQDTG SSTSASSRMI AQDLNDGYQV TEALRVQMEV  240
QRRLHEQLEV QRRLQLRIEA QSKYLQSILE KACKVLNDQA LVSAGLEVAR EELSELAIKV  300
ASDCQGVASV PSLTDVAASM ENTNASSMPA RIGDCSIESC LTTSNESPVS PLGGGSQAPA  360
AMKKRSRPEL GNVESLPLEG TMPQVDWVIS NIGS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A6e-19131187258Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B6e-19131187258Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A6e-19131187157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-19131187157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-19131187157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-19131187157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A6e-19131187258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C6e-19131187258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D6e-19131187258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F6e-19131187258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H6e-19131187258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J6e-19131187258Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:26586833). Acts redundantly with PHR1 as a key component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). {ECO:0000269|PubMed:26586833}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00378DAPTransfer from AT3G24120Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027120092.11e-178protein PHR1-LIKE 3-like isoform X1
SwissprotQ94A571e-128PHL2_ARATH; Protein PHR1-LIKE 2
TrEMBLA0A068TU041e-177A0A068TU04_COFCA; Uncharacterized protein
STRINGXP_006493809.11e-160(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37912344
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]