PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_9351_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family EIL
Protein Properties Length: 279aa    MW: 31791.1 Da    PI: 4.5036
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_9351_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN354.33.8e-172114214353
                                         HHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                                EIN3 214 ikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahssslrkqspkvtlsceqkedvegkk 288
                                         ikhm+p++++ir+l+ qsk lqd+m+a++s+++++v+nqee++         +    +++v++s + +++ eg++
  cra_locus_9351_iso_1_len_922_ver_3   2 IKHMAPDFNRIRRLVKQSKILQDRMTARDSATWSKVINQEESLS--------Q--LAQRSVKISPSMEDEEEGTR 66 
                                         9***************************************9854........2..25667888888776666555 PP

                                         XXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXX CS
                                EIN3 289 eskikhvqavkttagfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqne 353
                                          s                 +krk     s+ ++++     cq+  +++s+++ +f+dkns+ q+e
  cra_locus_9351_iso_1_len_922_ver_3  67 ISG---------------SEKRKC-MFVSEVIEDH-SLFACQNFMCPQSDVASGFEDKNSRIQHE 114
                                         555...............456663.3334444444.579**********************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.3180.105.1E-16248IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
PfamPF048734.7E-11242No hitNo description
SuperFamilySSF1167681.09E-13244IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
XIKHMAPDFN RIRRLVKQSK ILQDRMTARD SATWSKVINQ EESLSQLAQR SVKISPSMED  60
EEEGTRISGS EKRKCMFVSE VIEDHSLFAC QNFMCPQSDV ASGFEDKNSR IQHEKTCAYR  120
PNNVDHFDAN YVTTMDLPMY ESMVITNEKL PQSDHWMDIS EDSNEANIAE IVQEINRILD  180
IPPYDHLFPA TPDCMDSEDT INHEANITQV LQEVNGNLEN YRNCCGGAYV FRNQLRLDPT  240
SGNRTNLNLN VSPLEEALGV GHENAPSAWD LAYFHQGDP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A1e-1324684128Protein ETHYLENE INSENSITIVE 3
4zds_B1e-1324684128Protein ETHYLENE INSENSITIVE 3
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30423178