PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_9338_iso_4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 796aa    MW: 89102 Da    PI: 6.3263
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_9338_iso_4genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.13.6e-074082347
                                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                      Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                         +WT +E+e +  a +q G++ +++I  +++  +   q++++++ +
  cra_locus_9338_iso_4_len_2552_ver_3 40 AWTHQEEESFFSALRQVGKN-FEKITCRVQ-SKNKDQVRHYYYRL 82
                                         6*****************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.56E-93387IPR009057Homeodomain-like
PROSITE profilePS5129312.4583687IPR017884SANT domain
SMARTSM007176.0E-43785IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-43885IPR009057Homeodomain-like
CDDcd001675.56E-44083No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 796 aa     Download sequence    Send to blast
XGLHPENVVI VDGASGASKS LQDHAAPQQP VKKQTRQWAA WTHQEEESFF SALRQVGKNF  60
EKITCRVQSK NKDQVRHYYY RLVRRMNKLL GPELWLDAKN SKDTNAAMLR WWSLLEKYSC  120
KASKLHLKPR RFKLIVETLE NQLLKDRKKM VRKRSSQGEN NSVIAPATIL DQGRVPLPES  180
RTVKSVLVDT QNIQKFVTGK GPTLKRQVNM GINRSNYKSE ASSLKSSRHR RKTGGASTAA  240
YKRWEKAAIA GVSLVADAAE HLERTSTDRE VEHTEQNGYE YSEKDIPSLR NNLQNSEKLK  300
LQLFPIDEST RRALEMDNRN PHLELTLSTR KKISSVLEHL NRKWGDSNIA SGELMLFPYS  360
VQNANSEGYH RWTKDSTLTA ADVYALIGSP AVFRLRYGWF PLCEIGSMRS QAPSSCSNEQ  420
NRSMNAVHEC VLDSLPKSSP PTHHEHEKLS DFHKDRVSST PKMALTASAS MSTEMIQHCS  480
MPDISISRSS NHTSAPLLDG KESELCTIVE EDEHHGELRT QNAALSPGDW ADSLTNISFG  540
DLLSEPSENV DANGIDSDCP RTSDCLQQTP FTCDSFDAAI AAHIRKHGCR PSSEPPVLSH  600
APCIWDAEET CDAFSFQKNV FSENVDAFEK FPSQTFGEIA ETRAPQPGRE AEALSDADKT  660
FIDDPMDKSE SDGHTSDSSI RDFNSLTDIY WPDSLGALDL DIPSCRYRTD DLILSDSLGG  720
LNRLIASSLD AFQNCSFFGS EKKDSATVEA GETASVSDLK ISTEGXSICK WRKLELAEED  780
EHFDPEVSHQ KCLVFT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010653608.10.0PREDICTED: TSL-kinase interacting protein 1 isoform X2
SwissprotQ8LJT80.0TKI1_ARATH; TSL-kinase interacting protein 1
TrEMBLA0A068V8020.0A0A068V802_COFCA; Uncharacterized protein
STRINGVIT_08s0040g01460.t010.0(Vitis vinifera)