PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_9268_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 308aa    MW: 36560.6 Da    PI: 7.281
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_9268_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.83.7e-1179120446
                                          S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                      Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                          W + E++ll++++k++G g+W  +a+++g ++ + qc +++++
  cra_locus_9268_iso_2_len_1569_ver_3  79 WNAKEELLLLEGIKMYGFGNWYEVAEHVG-TKDRTQCLDHYNS 120
                                          *****************************.999999*****85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM002912.5E-61560IPR000433Zinc finger, ZZ-type
CDDcd023356.51E-171967No hitNo description
PROSITE profilePS501359.9691962IPR000433Zinc finger, ZZ-type
PfamPF005698.9E-71951IPR000433Zinc finger, ZZ-type
SuperFamilySSF578501.29E-121982No hitNo description
PROSITE patternPS0135702148IPR000433Zinc finger, ZZ-type
SuperFamilySSF466891.72E-1274125IPR009057Homeodomain-like
PROSITE profilePS5129320.33174126IPR017884SANT domain
SMARTSM007172.0E-875124IPR001005SANT/Myb domain
PfamPF002499.9E-1178120IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-878121IPR009057Homeodomain-like
CDDcd001673.46E-979121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0016573Biological Processhistone acetylation
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
METAYAGEGQ TVREEKVFYQ CNYCNKDIYR KIHIKCLRCS DFNLCVECFS VAAEVYPHRS  60
NHPYTVMDNL FFPLMCTDWN AKEELLLLEG IKMYGFGNWY EVAEHVGTKD RTQCLDHYNS  120
IYVHSPCVPV QEKYTEHLSM AHRQIIKDCN AEGSVREKQA RTSVEFVTEY GNDAQQLLAD  180
IEFKETDTDD ERELKLRVLR FYSKRLDERK CRKKFLLERN LLHPHLVETY LSPEEKEICR  240
PYRVFMRYHS TEEHANLLRT VVEEHRIRKR IQDLKDARAA GCRTPTEVER YIEQKSKRMK  300
ESTRAGPC
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016580486.11e-117PREDICTED: transcriptional adapter ADA2 isoform X2
SwissprotQ9ATB41e-105TAD2B_ARATH; Transcriptional adapter ADA2b
TrEMBLA0A103XLY91e-131A0A103XLY9_CYNCS; Homeodomain-like protein
STRINGPOPTR_0016s00940.11e-111(Populus trichocarpa)