PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_8528_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 468aa    MW: 51123.9 Da    PI: 6.383
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_8528_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.26e-1657101147
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                          r +WT+eE++++++a k++G   W+ I +++g ++t+ q++s+ qk+
  cra_locus_8528_iso_2_len_1932_ver_3  57 REKWTQEEHQRFLEALKLYGRA-WRQIEEHVG-TKTAIQIRSHAQKF 101
                                          789*****************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.94E-1551104IPR009057Homeodomain-like
PROSITE profilePS5129421.10652106IPR017930Myb domain
TIGRFAMsTIGR015575.1E-1655104IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.605.7E-95697IPR009057Homeodomain-like
SMARTSM007173.3E-1256104IPR001005SANT/Myb domain
PfamPF002494.8E-1357100IPR001005SANT/Myb domain
CDDcd001671.89E-959102No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MVAEAPVFDQ VEGSACEAPF GAGVHLESAA TQSQSLGAFG NGYTPKVRKP YTITKQREKW  60
TQEEHQRFLE ALKLYGRAWR QIEEHVGTKT AIQIRSHAQK FFAQVARDSK PDSEGSLNPM  120
EIPPPRPKKK PLHPYPRKVV NSQKYGAIDP NSHEQSPPNV TGLDRETRSP TSVFSAIGSD  180
ASGSPFSEPQ RSSRLSPTSC TSDNAHSANM LLRENDNECM TSDSSVEEER GFFQSTQLSA  240
PTYMDAKLVM EPDLLTIAGA YSLDNSASDE PSTTIKLFGK TVVLNESQKL SPSATESETT  300
TNDEELVVTD GQHFQNSATT DADPKFAFPF VPGSITPLPW FVPQYALSDE CSHAGLTPGS  360
IPWWALYQGV IFPPVSFGNQ TADSPYKGEQ QHELRDGSLT SSNSGSTGEV NSLQKKTVAV  420
ERKGKAKLLK HGSSRGFVPY KRCLAERDAT SVIVAAEEHK GPKNRVCL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A068TRG41e-153A0A068TRG4_COFCA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74472127