PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_8413_iso_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family FAR1
Protein Properties Length: 272aa    MW: 31035.4 Da    PI: 7.2361
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_8413_iso_3genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR192.84.5e-29106193291
                                 FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgk 75 
                                          fYn+YA++vGF +r+sk ++s+r+g+ + r +vC+keg+r ++k++  k  r+raetr+gC+a++ v+k ++gk
  cra_locus_8413_iso_3_len_1793_ver_3 106 FYNAYATKVGFVIRVSKLSRSRRDGSAIGRALVCNKEGFRMPDKRE--KIVRQRAETRVGCRAMILVRKVSSGK 177
                                          ******************************************9988..9************************* PP

                                 FAR1  76 wevtkleleHnHelap 91 
                                          w+vtk+++eH+H+l+p
  cra_locus_8413_iso_3_len_1793_ver_3 178 WVVTKFVKEHTHPLTP 193
                                          *************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.1E-26106193IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MEVYYYSXCN QNTFYLSVDF DIDGDVNGEV VGSSIDIEGR TDDEDAIAGT SVDGALKQGL  60
HIKIDEDLSR TQIVPLEEPQ TVNNSASNDE PYVGQEFESE AAAHAFYNAY ATKVGFVIRV  120
SKLSRSRRDG SAIGRALVCN KEGFRMPDKR EKIVRQRAET RVGCRAMILV RKVSSGKWVV  180
TKFVKEHTHP LTPGKGRKDL IYDQYPNEHD KIRELTQQLA VEKKRAATYK RHLEMIFEHI  240
EEHNQSLSKK IQNIVNNVRE MESKELQSRR XC
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011098324.11e-151PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A068V8N61e-155A0A068V8N6_COFCA; Uncharacterized protein
STRINGVIT_05s0102g00690.t011e-136(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA115682325