PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_8366_iso_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family EIL
Protein Properties Length: 539aa    MW: 62490.4 Da    PI: 4.7322
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_8366_iso_3genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3237.48.3e-73169378120353
                                          XXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.- CS
                                 EIN3 120 sgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtp 193
                                          ++++  ++++ss  h l+e+qDTtlgSLLsalmqhc ppqrrfple+g++pPWWPtG+elwwge+g+++++g+p
  cra_locus_8366_iso_3_len_1679_ver_3 169 EEHE--NMDPSSFIHLLQEIQDTTLGSLLSALMQHCVPPQRRFPLERGLPPPWWPTGNELWWGEQGTAHEHGAP 240
                                          4333..4589**************************************************************** PP

                                          ----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXXXX CS
                                 EIN3 194 pykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahsssl 267
                                          pykkphdlkkawkv++L++ ikhm+p++++ir+l+ qsk lqdkm++++++++++vlnqee++++        l
  cra_locus_8366_iso_3_len_1679_ver_3 241 PYKKPHDLKKAWKVTLLSSIIKHMAPDFNRIRRLVKQSKILQDKMTSRDTATWSKVLNQEESLIQ--------L 306
                                          *************************************************************9883........2 PP

                                          XXXXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXX CS
                                 EIN3 268 rkqspkvtlsceqkedvegkkeskikhvqavkttagfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetel 341
                                             ++++++s +++ d eg++e          + ++++  +krk     +++ +++     cq+  +++s++  
  cra_locus_8366_iso_3_len_1679_ver_3 307 --AQRSLKISPSNE-DEEGEQEDL--------ALTKVSGSEKRK-CVFVPEAREDT--LFACQNFLCPESDVCS 366
                                          ..456677887754.666666666........222455566776.34444454444..79************** PP

                                          XXXXXXXXXXXX CS
                                 EIN3 342 ifadknsisqne 353
                                          +f dkns++q+e
  cra_locus_8366_iso_3_len_1679_ver_3 367 GFVDKNSRTQHE 378
                                          **********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048733.8E-66157301No hitNo description
Gene3DG3DSA:1.10.3180.107.9E-66177307IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167686.54E-58180304IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 539 aa     Download sequence    Send to blast
XHSSDEYPRE GKSVQTMVTA DMREPELVYP WIFLDMKIIH SHRHSSSLFK PSYLCEFSRT  60
KLYFALIIRV IVFVSVKAKM VKFDEEIFEP LSPSSEIEDQ EFEAEDISYD DLKKRMWKDR  120
MHMQKLKAQR PIPEPDPQAK EDISKRKKME ELKILFPAAI AEFLPKILEE HENMDPSSFI  180
HLLQEIQDTT LGSLLSALMQ HCVPPQRRFP LERGLPPPWW PTGNELWWGE QGTAHEHGAP  240
PYKKPHDLKK AWKVTLLSSI IKHMAPDFNR IRRLVKQSKI LQDKMTSRDT ATWSKVLNQE  300
ESLIQLAQRS LKISPSNEDE EGEQEDLALT KVSGSEKRKC VFVPEAREDT LFACQNFLCP  360
ESDVCSGFVD KNSRTQHEKL CTYRPADENI SGLDLQIYEN EFSPDHPESI VSYEQQHQSD  420
NIAEIVQEVN RTLELPIFYS GHNNEVDFLP NQETMVSNGR QLQELDWMDL VLPENEANIA  480
EVVQELNKNV DYRNYLIGIS ENTMDLNLNI SPLEEALRSS TQLNTPSVWD LAYIDEEQS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A4e-581783051128Protein ETHYLENE INSENSITIVE 3
4zds_B4e-581783051128Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090514.11e-122PREDICTED: LOW QUALITY PROTEIN: putative ETHYLENE INSENSITIVE 3-like 4 protein
SwissprotQ9LX161e-91EIL4_ARATH; Putative ETHYLENE INSENSITIVE 3-like 4 protein
TrEMBLK7L6K01e-111K7L6K0_SOYBN; Uncharacterized protein
STRINGGLYMA08G14630.21e-111(Glycine max)