PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_8079_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 188aa    MW: 19976.2 Da    PI: 10.624
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_8079_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.65e-322479156
                             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56
                                        k+r++W+peLH+rF+ a++qLGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  cra_locus_8079_iso_1_len_881_ver_3 24 KTRRCWSPELHKRFLMALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 79
                                        68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.5512181IPR017930Myb domain
SuperFamilySSF466892.33E-182281IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.3E-282282IPR009057Homeodomain-like
TIGRFAMsTIGR015579.6E-272479IPR006447Myb domain, plants
PfamPF002495.7E-82677IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
GGGGGGGGGN KKDEKEKETQ SARKTRRCWS PELHKRFLMA LQQLGGSHVA TPKQIRELMK  60
VDGLTNDEVK SHLQKYRLHN RRPSSSIHNN NNNPQAPQFV VVGGIWVPPP VEYAAMATTT  120
GSGGEASGGA NSNGIYAPIA TLPSPPPPQV ANKQRQQHHK QPRSCHRGSH SGGGASSSTD  180
TTTASPSY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-142477255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-142477255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A3e-142477154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-142477154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-142477154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-142477154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-142477255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-142477255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-142477255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-142477255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-142477255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-142477255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phosphate signaling in roots. {ECO:0000250|UniProtKB:Q9FX67}.
UniProtTranscriptional repressor that may play a role in response to nitrogen. May be involved in a time-dependent signaling for transcriptional regulation of nitrate-responsive genes. Binds specifically to the DNA sequence motif 5'-GAATC-3' or 5'-GAATATTC-3'. Represses the activity of its own promoter trough binding to these motifs.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by nitrate. {ECO:0000269|PubMed:23324170}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027153359.16e-81transcription factor HHO3-like
SwissprotQ6Z8691e-47NIGT1_ORYSJ; Transcription factor NIGT1
SwissprotQ9FPE84e-48HHO3_ARATH; Transcription factor HHO3
TrEMBLA0A068TX105e-76A0A068TX10_COFCA; Uncharacterized protein
STRINGVIT_01s0011g03110.t011e-68(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52192438
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Sawaki N, et al.
    A nitrate-inducible GARP family gene encodes an auto-repressible transcriptional repressor in rice.
    Plant Cell Physiol., 2013. 54(4): p. 506-17
    [PMID:23324170]
  3. Nagarajan VK,Satheesh V,Poling MD,Raghothama KG,Jain A
    Arabidopsis MYB-Related HHO2 Exerts a Regulatory Influence on a Subset of Root Traits and Genes Governing Phosphate Homeostasis.
    Plant Cell Physiol., 2016. 57(6): p. 1142-52
    [PMID:27016098]