PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_78154_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 125aa    MW: 14164 Da    PI: 10.392
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_78154_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like70.52.5e-221159554
                              G2-like  5 rWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54
                                         +Wt++LHe+F+ av+qL G+ +  Pk ile+m+v+gLt+ +v+SHLQk R
  cra_locus_78154_iso_1_len_375_ver_3 11 EWTSDLHEKFMAAVAQL-GEGRCYPKDILEIMNVPGLTRMQVASHLQKCR 59
                                         7****************.9*****************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.727163IPR017930Myb domain
SuperFamilySSF466893.27E-16659IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.3E-22860IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-191160IPR006447Myb domain, plants
PfamPF002498.5E-71158IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 125 aa     Download sequence    Send to blast
AGQVKRKICT EWTSDLHEKF MAAVAQLGEG RCYPKDILEI MNVPGLTRMQ VASHLQKCRN  60
DNWRVPERKN KGNGGEGSSS TKKDHVRRFG TMPKSFMNYQ QEKNQEKSSE KNPIPAAETA  120
NGRRS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019176860.11e-37PREDICTED: two-component response regulator ORR26-like
TrEMBLA0A1U7Y2993e-35A0A1U7Y299_NICSY; two-component response regulator ARR2-like
TrEMBLS8D9N53e-35S8D9N5_9LAMI; Uncharacterized protein (Fragment)
STRINGXP_009798262.16e-36(Nicotiana sylvestris)
STRINGXP_009595757.13e-38(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8132384