PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_7793_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 325aa    MW: 35366.4 Da    PI: 4.9984
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_7793_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.31.1e-30267317151
                              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                                          k+r+rWtpeLHe+Fveav++LGGse+AtPk +l+lmkv+gLt++hvkSHLQ
  cra_locus_7793_iso_2_len_1362_ver_3 267 KQRMRWTPELHEAFVEAVNKLGGSERATPKGVLKLMKVEGLTIYHVKSHLQ 317
                                          79************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.866264324IPR017930Myb domain
SuperFamilySSF466897.35E-16265319IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-27266317IPR009057Homeodomain-like
TIGRFAMsTIGR015578.0E-23267318IPR006447Myb domain, plants
PfamPF002496.1E-9269317IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0016036Biological Processcellular response to phosphate starvation
GO:0055063Biological Processsulfate ion homeostasis
GO:0071486Biological Processcellular response to high light intensity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MEARPTLSIP RSSAPQLSSF GASGALSTAI PVVPTALEEK YPKLPDSQQL SMERGIRQCP  60
PATFSPISSN SGVVGHMFSS SPGFSTDLHF SSISQQEKHS RQVPFIPQST GDGSSVLLPH  120
SSHSEVIQSE ASSQYTKENN DPSWCPDSLS EFLDYPVNTS LQNNQIDSGN SLEGILQPED  180
LSKRNWQEWA DQLISDDDAL TSSWTDLIGD NGVTDLEPKT QMQYQVPKQS TNSSMQQPQV  240
SQQLPASSGE TCLAITPSAC VSSAPTKQRM RWTPELHEAF VEAVNKLGGS ERATPKGVLK  300
LMKVEGLTIY HVKSHLQVCC VLLLH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-28267317252Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-28267317252Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-28267317252Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-28267317252Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-28267317252Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-28267317252Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-28267317252Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-28267317252Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027158343.11e-151protein PHOSPHATE STARVATION RESPONSE 1-like isoform X2
TrEMBLA0A068U6I51e-146A0A068U6I5_COFCA; Uncharacterized protein
STRINGXP_002526559.11e-132(Ricinus communis)