PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_7610_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 61aa    MW: 6747.72 Da    PI: 4.8191
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_7610_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.83.9e-111651137
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-H CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtl 37
                                         +g+WT eEd++l+++++ +G g W++ ar  g +++l
  cra_locus_7610_iso_2_len_1045_ver_3 16 KGPWTMEEDLILINYIANHGEGVWNSLARSAG-TLSL 51
                                         79******************************.9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-12845IPR009057Homeodomain-like
SuperFamilySSF466894.64E-8845IPR009057Homeodomain-like
PROSITE profilePS500907.0391144IPR017877Myb-like domain
PfamPF002497.8E-91650IPR001005SANT/Myb domain
CDDcd001671.58E-51848No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 61 aa     Download sequence    Send to blast
MDKKPGNNSQ DVEVRKGPWT MEEDLILINY IANHGEGVWN SLARSAGTLS LIICSSTIIF  60
I
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015879077.16e-24PREDICTED: myb-related protein 305-like
SwissprotP813912e-25MYB05_ANTMA; Myb-related protein 305
TrEMBLQ70RD21e-24Q70RD2_GERHY; MYB8 protein
STRINGVIT_14s0066g01090.t011e-21(Vitis vinifera)
STRINGSolyc02g086690.2.11e-21(Solanum lycopersicum)