PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_7378_iso_4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family CO-like
Protein Properties Length: 397aa    MW: 43135.1 Da    PI: 7.0886
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_7378_iso_4genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box23.31.4e-072566438
                             zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg.......Ht 38
                                         + C+ +++  + lfC++++ ++C +C ++ H         H+
  cra_locus_7378_iso_4_len_1863_ver_3 25 KQCDYCNSAAALLFCRTDSAFMCISCDSKVHATnklgsrqHE 66
                                         68*******9*******************9965556666665 PP

2zf-B_box26.51.4e-0868113342
                             zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                                           ++C+ +e+ +++  C+ +   lC +C   +H+       H+++p+
  cra_locus_7378_iso_4_len_1863_ver_3  68 VWMCEVCEQAPASVTCKADAAALCVTCDRDIHSAnplarrHERSPV 113
                                          689*****************************66888888998875 PP

3CCT706.2e-24319362144
                                  CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                          Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k+a
  cra_locus_7378_iso_4_len_1863_ver_3 319 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRA 362
                                          9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003362.3E-62270IPR000315B-box-type zinc finger
PfamPF006434.8E-62567IPR000315B-box-type zinc finger
PROSITE profilePS501199.1152770IPR000315B-box-type zinc finger
CDDcd000212.70E-82770No hitNo description
PROSITE profilePS5011910.80866113IPR000315B-box-type zinc finger
PfamPF006431.2E-668113IPR000315B-box-type zinc finger
CDDcd000211.72E-969113No hitNo description
SMARTSM003362.3E-1071113IPR000315B-box-type zinc finger
PfamPF062037.8E-18319361IPR010402CCT domain
PROSITE profilePS5101716.787319361IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MGMQETVGIG GGGKNFPAGW GLVAKQCDYC NSAAALLFCR TDSAFMCISC DSKVHATNKL  60
GSRQHERVWM CEVCEQAPAS VTCKADAAAL CVTCDRDIHS ANPLARRHER SPVVPFYDTA  120
ESVVKSTAAV AAAANFLVPP VHNNGVSENL STCLANDSYV TDSSWISSSD PTAPRVAADG  180
PDLKSMEFLF TDSDNYLDFD YPISSVQQHY SSGNDGVVPV QTTKAPPIPT TQLPVAGHSS  240
EKHFEIDFTK SHMTSYNNSY NPHSLSHSVS SSSLDVGVVP DGSCMSEISY PFGSSNTVDM  300
SGSNGNNQGS STQMVGMDRE ARVLRYREKR KNRKFEKTIR YASRKAYAET RPRIKGRFAK  360
RADQVVESHI DRIFNPNSAS SVTSFIPESR FGVVPSF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027068408.11e-175zinc finger protein CONSTANS-LIKE 4-like
TrEMBLA0A068U4411e-173A0A068U441_COFCA; Uncharacterized protein
STRINGVIT_11s0052g01800.t011e-131(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376