PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_7319_iso_6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 335aa    MW: 36211.3 Da    PI: 8.9974
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_7319_iso_6genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.48.1e-14115159347
                                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                          +WT+eE+  ++ + ++lG+g+W+ I+r + ++Rt+ q+ s+ qky
  cra_locus_7319_iso_6_len_1484_ver_3 115 PWTEEEHRCFLVGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKY 159
                                          8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.532318IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.747108164IPR017930Myb domain
SuperFamilySSF466899.72E-18109164IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-18111163IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.605.8E-11112158IPR009057Homeodomain-like
SMARTSM007171.5E-10112162IPR001005SANT/Myb domain
CDDcd001675.66E-9115160No hitNo description
PfamPF002491.9E-11115159IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MGRKCSHCGN IGHNSRTCTT YRGTHHGGGG GGVLRLFGVQ LHDIPSSSSI SNMMKKSFSL  60
DCLSSSSPAA SSSSPSNSSL SSSRIYINEA SDKMAIGYLS DGLIGRPQER KKGVPWTEEE  120
HRCFLVGLEK LGKGDWRGIS RNFVTTRTPT QVASHAQKYF LRQASLSKKL KRRSSLFDMI  180
ESKSTHNHQA IINDTIGGHD YPRRKGNLHL DDDNDDRVVE GYNINPPLID LNSFGVDQMD  240
GHDQEQCRTS SDHHGNFMAI SWAYDQSPAA GSGHQSQVTS NTTNRMSSMG ASSSNAAAPA  300
PDLELTLAAP KTVAQKKPSP PSSNSILLGP IISVI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00565DAPTransfer from AT5G56840Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007012873.13e-81Myb-like transcription factor family protein, putative
TrEMBLA0A068U6I01e-92A0A068U6I0_COFCA; Uncharacterized protein
STRINGVIT_04s0008g00900.t011e-72(Vitis vinifera)