PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_7303_iso_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family HSF
Protein Properties Length: 452aa    MW: 51281.2 Da    PI: 4.8627
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_7303_iso_3genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind98.85.4e-31592032102
                                          HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE---SSBTTTT. CS
                         HSF_DNA-bind   2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkvkdeekksks. 74 
                                          Fl+k++e++ed++++++isws+  nsf+v+d+++++ ++Lp+yFkhsnf+SF+RQLn+Y   ++   +++  + 
  cra_locus_7303_iso_3_len_1879_ver_3  59 FLTKTFEMVEDPSTDSVISWSKARNSFIVWDSHKLSATLLPRYFKHSNFSSFIRQLNTYKHXNSAAVRTNFVKl 132
                                          9*************************************************************999999887779 PP

                                          ...........................................XTTSEEEEESXXXXXXXXXXXXXXXXXX CS
                         HSF_DNA-bind  75 ...........................................kekiweFkhksFkkgkkellekikrkks 102
                                                                                     +++ weF+++ F  g+k+ll++i+r+++
  cra_locus_7303_iso_3_len_1879_ver_3 133 lkixwmcgyleilmsstgcixxlfddsgilvtieeanxgfrkvDPDRWEFANEGFLGGQKHLLKNIRRRRN 203
                                          **************************9999999988777765449***********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004155.6E-4555201IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467856.62E-2855125IPR011991Winged helix-turn-helix DNA-binding domain
Gene3DG3DSA:1.10.10.105.5E-3455125IPR011991Winged helix-turn-helix DNA-binding domain
PRINTSPR000562.0E-145982IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004471.2E-2659201IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.0E-1497109IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.0E-14110122IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467856.62E-28169201IPR011991Winged helix-turn-helix DNA-binding domain
Gene3DG3DSA:1.10.10.105.5E-34169201IPR011991Winged helix-turn-helix DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009644Biological Processresponse to high light intensity
GO:0010200Biological Processresponse to chitin
GO:0010286Biological Processheat acclimation
GO:0034605Biological Processcellular response to heat
GO:0034620Biological Processcellular response to unfolded protein
GO:0042542Biological Processresponse to hydrogen peroxide
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0071456Biological Processcellular response to hypoxia
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 452 aa     Download sequence    Send to blast
XCYKHQSSEL YLKISQQMEK NVTVKLEEES LLYPCDGGGA SSSSPQPMEG LNEIGPPPFL  60
TKTFEMVEDP STDSVISWSK ARNSFIVWDS HKLSATLLPR YFKHSNFSSF IRQLNTYKHX  120
NSAAVRTNFV KLLKIXWMCG YLEILMSSTG CIXXLFDDSG ILVTIEEANX GFRKVDPDRW  180
EFANEGFLGG QKHLLKNIRR RRNVVHSIHQ QGGGPCVELG HYGMEEELER LKRDRNLLMT  240
EIIKLKQQQQ SSRDQALAME ERIRMTEKKQ QQIMSFLAKA FSNPTFIQQY VDKYGQRKGQ  300
QHIEIGQKRR LTLSPSEENL QDVVSVAVAS DQPLNYASQD QELVNMQMEM ETLFSAALDN  360
ESSSNANISA SSIPTTGVAN LDPVTENIWQ ELLSEDLTTG NEAEEVLVID EPEADVEVED  420
LAATSPDWDG HVQQPSIEPF KHPQLCSRNQ FL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5u_B7e-185020117129Heat shock factor protein 1
5d5v_B7e-185020117129Heat shock factor protein 1
5d5v_D7e-185020117129Heat shock factor protein 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009799323.11e-169PREDICTED: heat shock factor protein HSF30 isoform X1
RefseqXP_009799324.11e-169PREDICTED: heat shock factor protein HSF30 isoform X2
SwissprotP411521e-137HSF30_SOLPE; Heat shock factor protein HSF30
TrEMBLA0A0V0I9411e-158A0A0V0I941_SOLCH; Putative heat shock factor protein HSF30-like
STRINGPGSC0003DMT4000212341e-154(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA57224113