PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_73018_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 160aa    MW: 18416.3 Da    PI: 6.9353
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_73018_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.52.8e-172465447
                                         S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                      Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                          T+ E++l +d++++lG++ W++Ia++++ gRt++++k++w+++
  cra_locus_73018_iso_1_len_478_ver_3 24 LTEVEEQLVIDLHARLGNR-WSKIAARLP-GRTDNEIKNHWNTH 65
                                         699****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.612115IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.605.7E-5214IPR009057Homeodomain-like
SuperFamilySSF466894.61E-21275IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.1E-251571IPR009057Homeodomain-like
PROSITE profilePS5129426.6381670IPR017930Myb domain
SMARTSM007173.3E-152068IPR001005SANT/Myb domain
PfamPF002491.7E-152365IPR001005SANT/Myb domain
CDDcd001675.31E-122566No hitNo description
PROSITE patternPS0015709199IPR020878Ribulose bisphosphate carboxylase, large chain, active site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0015977Biological Processcarbon fixation
GO:0000287Molecular Functionmagnesium ion binding
GO:0003677Molecular FunctionDNA binding
GO:0016984Molecular Functionribulose-bisphosphate carboxylase activity
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
RRCGKSCRLR WTNYLRPDLK RGLLTEVEEQ LVIDLHARLG NRWSKIAARL PGRTDNEIKN  60
HWNTHIKKKL VKMGIDPVTH EPLRNEKSEG GDDFDKDDEM QQPKPNSTAS SKQSSCSPTD  120
QNNNSSGESN WKLYENDPLI NSLFGEDFPQ VDIPWEIPSX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-2127040108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011081193.15e-65PREDICTED: protein ODORANT1
SwissprotQ50EX67e-59ODO1_PETHY; Protein ODORANT1
TrEMBLA0A059PRE26e-70A0A059PRE2_SALMI; MYB-related transcription factor
STRINGVIT_00s1241g00010.t012e-56(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154