PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_72631_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family FAR1
Protein Properties Length: 143aa    MW: 16125.6 Da    PI: 4.6873
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_72631_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR155.42e-1766142380
                                 FAR1   3 YneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkw 76 
                                          Y++YA+ +GF+vr+ k+++   ++++ ++t++Cskeg ++++ ++ +    +++etrtgCka++    +++g+w
  cra_locus_72631_iso_1_len_476_ver_3  66 YCDYAQAMGFNVRRGKQYYFMGTKRVRSKTYCCSKEGVKDDKADA-NGVGYKKPETRTGCKAMISFACDDNGQW 138
                                          99***************************************9988.888899********************** PP

                                 FAR1  77 evtk 80 
                                          +vtk
  cra_locus_72631_iso_1_len_476_ver_3 139 KVTK 142
                                          **97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.1E-1466142IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MENSGLDLER HEPISGDSDE EEAVRPRSGG EVVDVNEGPD EAHVHELEKN LLDQVVYSEE  60
EAYMSYCDYA QAMGFNVRRG KQYYFMGTKR VRSKTYCCSK EGVKDDKADA NGVGYKKPET  120
RTGCKAMISF ACDDNGQWKV TKX
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011093602.16e-86PREDICTED: uncharacterized protein LOC105173527 isoform X1
RefseqXP_011093603.12e-86PREDICTED: uncharacterized protein LOC105173527 isoform X2
TrEMBLA0A022QPC43e-83A0A022QPC4_ERYGU; Uncharacterized protein
STRINGBRADI4G41960.12e-30(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1451779