PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_7149_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family FAR1
Protein Properties Length: 706aa    MW: 82058.1 Da    PI: 6.7247
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_7149_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR168.61.6e-2169156291
                                 FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgk 75 
                                           Yn+YA+++GFsvrk ++k +  +g  + ++f+C+kegk+ ++++   ++  ++a  rt+Cka+++ +++++g 
  cra_locus_7149_iso_2_len_2783_ver_3  69 LYNDYAYKLGFSVRKGRQKCKAGSGIKYLKQFTCYKEGKKCDRRNV--NKCYSKADVRTNCKAMIEFRLNEKGG 140
                                          7**************************************9998766..89999********************* PP

                                 FAR1  76 wevtkleleHnHelap 91 
                                          w v+k +++HnHel+p
  cra_locus_7149_iso_2_len_2783_ver_3 141 WTVSKHVTNHNHELCP 156
                                          **************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.0E-1969156IPR004330FAR1 DNA binding domain
PfamPF105512.6E-28278371IPR018289MULE transposase domain
PROSITE profilePS509668.691556594IPR007527Zinc finger, SWIM-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 706 aa     Download sequence    Send to blast
MENCGKSVVA SCDELDIADC DVFNSPGVDE DSLKPQECEE EEVSPVTEIC NEHSLVDTTV  60
RSEEDAFELY NDYAYKLGFS VRKGRQKCKA GSGIKYLKQF TCYKEGKKCD RRNVNKCYSK  120
ADVRTNCKAM IEFRLNEKGG WTVSKHVTNH NHELCPANQK HLMRSQRTAT KNHVGNFQEM  180
KDSGISIVDD LTVLKKRVEG SSFADFTSRD VYNSLRSVKS KDLDGEDTNA LIQIFRWRTE  240
NEDDFYFDFE VDCNSSLCSF FWRDGRMKSD YDLFGDLLVY DTTYRTNKYE MICSPFVGMD  300
NHCRNIMFGC GFLKSEKTES FIWLFNTFLK SMKGKHPITL MSNESVAMAA ATGVVFPETR  360
HRLCIWHISE NSKQHLMGLR SKEDFVKLFN HVLKHTDTVS EFEFHWKRLM DNFCCHNDKW  420
LNNLYNMREK WCPAFNKDFF SGGILSSQRS EATHHAIFRR LSKTSTLCDF YRIFVEVISE  480
WRSNENMEDF PCNQGHVEMA LPNSKLLQHA NGIYTIEAYL LFEEQFMKFP EYCQGLVLSN  540
DGQHVYEIWH PDMISIRHTV VFNEHTMCIS CTCKMFNEVG VLCSHCLRIM NFHCVQVIPD  600
KYILKRWKGN REIENAEKVN KKDIEVSSVW RRQMIRKFSD LISASELNVN ARECVQEGFK  660
TMSDKIVADV GSYYVNDLEN EGVSSNIKDP IGSYAKEERN VRKKNC
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14143211