PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_7019_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 339aa    MW: 37176.3 Da    PI: 7.7901
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_7019_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.26.6e-32107160255
                              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                          pr+rWt++LH++Fv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  cra_locus_7019_iso_1_len_1244_ver_3 107 PRMRWTSTLHAHFVHAVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 160
                                          9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.15E-15104161IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-28105161IPR009057Homeodomain-like
TIGRFAMsTIGR015578.1E-24107160IPR006447Myb domain, plants
PfamPF002495.7E-7108159IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
GO:0005524Molecular FunctionATP binding
GO:0008026Molecular FunctionATP-dependent helicase activity
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MGGYDRSARK SSYSSSSTTD SGSCGSDLSH ENGLIDHHQR THEPNLSLLG FEMVQNFQAN  60
NYYGHGVGHY QPQIYGRDKF KRNSRSTLMM NNNNGGCLMM KRNVRAPRMR WTSTLHAHFV  120
HAVQLLGGHE RATPKSVLEL MNVKDLTLAH VKSHLQMYRT VKSTDKGLSR PPSGELGEFD  180
MSLNNQRSAG RIVEIDDDDD DNGGNGIGLI GMKCSSDRMA LSISSSGPTT LQNAQRSLCS  240
SSPQTNLWMH PPSQELTLNH HDLGLTPNPK SEEGIGEVQQ QVTADKEKIG SSRSSNDRWT  300
TSLAASSSSS SDHHLMLNLE FTLGRPNTAG TALTILPLT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A4e-17108162357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-17108162357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-17108162357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-17108162357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027148700.12e-73probable transcription factor KAN4
TrEMBLA0A068UG961e-66A0A068UG96_COFCA; Uncharacterized protein