PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_6982_iso_4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 391aa    MW: 44622.9 Da    PI: 6.7885
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_6982_iso_4genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.13.7e-12107147445
                                          S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
                      Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                          W ++E+ ll+++++++G+g+W+ + +++g +++ ++c+++++
  cra_locus_6982_iso_4_len_1283_ver_3 107 WKADEEILLLEGIEMYGMGNWAEVGEHVG-TKSKESCIEHYR 147
                                          *****************************.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0250245.4E-11534391IPR016827Transcriptional adaptor 2
PROSITE profilePS5013510.9814390IPR000433Zinc finger, ZZ-type
SMARTSM002913.4E-104388IPR000433Zinc finger, ZZ-type
PfamPF005691.5E-104688IPR000433Zinc finger, ZZ-type
CDDcd023351.76E-254795No hitNo description
SuperFamilySSF578501.18E-1447110No hitNo description
PROSITE patternPS0135704976IPR000433Zinc finger, ZZ-type
SuperFamilySSF466892.11E-1199153IPR009057Homeodomain-like
PROSITE profilePS5129320.903102154IPR017884SANT domain
SMARTSM007175.2E-10103152IPR001005SANT/Myb domain
PfamPF002491.2E-11106148IPR001005SANT/Myb domain
CDDcd001671.52E-10107147No hitNo description
Gene3DG3DSA:1.10.10.603.8E-7107149IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0016573Biological Processhistone acetylation
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MGRSRGNFQA EEDPSQRSRR RKNASNGENI ESVGAGQGTT EGKRALYHCN YCNKDISGRM  60
RIKCAVCSDF DLCIECFSVG AEVHPHKSNH PYRVMDVLSF PLICPDWKAD EEILLLEGIE  120
MYGMGNWAEV GEHVGTKSKE SCIEHYRSAY LNSPYFPLPD MTHVIGKNRK ELLAMAKGHT  180
EDKKGLSSHG EFAPKEESPF SPSRVKVEDS HKSSPSGRLP SGAPVAGKIA KKKASKNVQV  240
KDQPDSVKPD GRNVDSNKSE SSKLEGSSLM DLSGYNLKRQ EFDPEYDNDA ENLLADMEFK  300
ETDTEEEQEI KLRVLRLYSK RLDERKRRKD FILDRNLLHQ NAFEKDLSQE EKALCRNYDP  360
FMRFLSKEEY EEFIKSVVAE HRILKRIQEL X
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1324329RKRRKD
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011086259.10.0PREDICTED: transcriptional adapter ADA2b-like
SwissprotQ9ATB41e-166TAD2B_ARATH; Transcriptional adapter ADA2b
TrEMBLA0A068U7L70.0A0A068U7L7_COFCA; Uncharacterized protein
STRINGVIT_00s0194g00130.t010.0(Vitis vinifera)