PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_6959_iso_5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 271aa    MW: 30032.8 Da    PI: 8.0775
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_6959_iso_5genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like108.34e-342276155
                              G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                         k+rlrWt+eLHerFv+av+qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  cra_locus_6959_iso_5_len_2125_ver_3 22 KQRLRWTNELHERFVDAVAQLGGPDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 76
                                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.3371979IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-322177IPR009057Homeodomain-like
SuperFamilySSF466892.87E-182176IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-262277IPR006447Myb domain, plants
PfamPF002491.0E-92475IPR001005SANT/Myb domain
PfamPF143792.0E-23108154IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MDFMGGGNNN MNNSNNSNLA SKQRLRWTNE LHERFVDAVA QLGGPDRATP KGVLRVMGVQ  60
GLTIYHVKSH LQKYRLAKYL PDSSSDGKKT DKKDSKEMLS NLDGSSGMQI TEALKLQMEV  120
QKRLHEQLEV QKQLQLRIEA QGKYLKKIIE EQQRLSGVLS DAPSAGVTAN QLGDNCPESE  180
IRNDPGTPPP TSESPVMDKP SKERAAAKSF SLDESFSSPQ EPQTPESGCR INLFENMDAD  240
RSSKKQRLSP SGLPPQISNV CPPFEQPHSI F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A7e-252279158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B7e-252279158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C7e-252279158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D7e-252279158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00252DAPTransfer from AT2G01060Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006349121.11e-138PREDICTED: myb family transcription factor APL-like
RefseqXP_006349122.11e-138PREDICTED: myb family transcription factor APL-like
RefseqXP_015164958.11e-138PREDICTED: myb family transcription factor APL-like
SwissprotQ9SJW01e-114PHL7_ARATH; Myb family transcription factor PHL7
TrEMBLM1ABL41e-136M1ABL4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000190991e-137(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27962451