PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_6959_iso_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 250aa    MW: 27793.3 Da    PI: 8.3068
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_6959_iso_3genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like513.3e-1626552655
                              G2-like 26 kAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                          AtPk +l++m+v+gLt++hvkSHLQkYRl
  cra_locus_6959_iso_3_len_1240_ver_3 26 GATPKGVLRVMGVQGLTIYHVKSHLQKYRL 55
                                         59***************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.15E-62355IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-152556IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-112656IPR006447Myb domain, plants
PfamPF143791.7E-2387133IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
XPLLYFSQEC FLYPSRFVKF GFSVSGATPK GVLRVMGVQG LTIYHVKSHL QKYRLAKYLP  60
DSSSDGKKTD KKDSKEMLSN LDGSSGMQIT EALKLQMEVQ KRLHEQLEVQ KQLQLRIEAQ  120
GKYLKKIIEE QQRLSGVLSD APSAGVTANQ LGDNCPESEI RNDPGTPPPT SESPVMDKPS  180
KERAAAKSFS LDESFSSPQE PQTPESGCRI NLFENMDADR SSKKQRLSPS GLPPQISNVC  240
PPFEQPHSIF
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00252DAPTransfer from AT2G01060Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006349121.11e-109PREDICTED: myb family transcription factor APL-like
RefseqXP_006349122.11e-109PREDICTED: myb family transcription factor APL-like
RefseqXP_015164958.11e-109PREDICTED: myb family transcription factor APL-like
SwissprotQ9SJW03e-90PHL7_ARATH; Myb family transcription factor PHL7
TrEMBLA0A0V0HT251e-108A0A0V0HT25_SOLCH; Putative myb family transcription factor APL-like
STRINGPGSC0003DMT4000190991e-108(Solanum tuberosum)