PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_6851_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family FAR1
Protein Properties Length: 552aa    MW: 62342.1 Da    PI: 6.6412
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_6851_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR172.21.1e-2271160290
                                 FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkk.tekerrtraetrtgCkaklkvkkekdg 74 
                                           Y++YA+ vGFsvrk k+++   +++i  ++++Cskeg++++++++ +  ++ ++ etrtgCka++    +++g
  cra_locus_6851_iso_2_len_2549_ver_3  71 LYCDYAYAVGFSVRKGKQYYFPGTNKIRAKWYCCSKEGFSNDKDDSsSGITSGHKLETRTGCKAMIYFACNNEG 144
                                          7********************9999**************99999883445566899****************** PP

                                 FAR1  75 kwevtkleleHnHela 90 
                                          +w+ +k++++HnHe+a
  cra_locus_6851_iso_2_len_2549_ver_3 145 QWKASKFVKQHNHEMA 160
                                          **************96 PP

2FAR169.67.6e-22256341290
                                 FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgk 75 
                                           Y++YA+ +GFsvrk k+++   ++++ ++ + Cskeg+ +e+ +    + +++ e rtgCka+++ + ++dgk
  cra_locus_6851_iso_2_len_2549_ver_3 256 VYCNYAHIMGFSVRKGKQYYFPGTKRVRSKSYFCSKEGFVNEDISV---ATHNKLEARTGCKAMINFTCDDDGK 326
                                          7****************************************99877...8999********************* PP

                                 FAR1  76 wevtkleleHnHela 90 
                                          w+v+k++++HnH++a
  cra_locus_6851_iso_2_len_2549_ver_3 327 WKVAKFVKDHNHKMA 341
                                          ************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031015.4E-2071160IPR004330FAR1 DNA binding domain
PfamPF031018.2E-19256341IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 552 aa     Download sequence    Send to blast
MINSGNASKK CRKLDNVISV DNYDDEEEVK WICLGCTGEE AVNIKWKAYI EELENLLGNQ  60
VLQCEEEAYK LYCDYAYAVG FSVRKGKQYY FPGTNKIRAK WYCCSKEGFS NDKDDSSSGI  120
TSGHKLETRT GCKAMIYFAC NNEGQWKASK FVKQHNHEMA ELYERQFLRS ARAIFASNYG  180
QAETMVSEIS NSGHEVQCST DVMYLDNDEE DEFICFHCTG GDETTVSDDS QDRDVDDLEK  240
KLLGQVVRCE EEAYKVYCNY AHIMGFSVRK GKQYYFPGTK RVRSKSYFCS KEGFVNEDIS  300
VATHNKLEAR TGCKAMINFT CDDDGKWKVA KFVKDHNHKM AEPHERHLLR SARSISDSAK  360
GNNISQAMML DLNKGIGKAG ISGGQSIGKG DTISEPHVGM EFQTEDAAKA FYDEYAKQVG  420
FLMHLMPNGP FEVGGRNDLV SAGYQPRSGA GCQAMILLSC DKSGKCIVSR FLRDHNHPLV  480
TFPTEVGYTM CLFLXDVKDR KIQELKMELQ NKRKLCGFYR EQLAAVVKVV EEHTKEISRK  540
HDLAVNNLQG VG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011093605.18e-48PREDICTED: protein FAR1-RELATED SEQUENCE 12-like isoform X3
TrEMBLA0A068V9220.0A0A068V922_COFCA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1451779