PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_6684_iso_6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family CO-like
Protein Properties Length: 348aa    MW: 38719.2 Da    PI: 5.7034
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_6684_iso_6genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.84e-071143436
                             zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg 36
                                         + C+ ++   ++ fC+ ++ +lC +C ++ H+ 
  cra_locus_6684_iso_6_len_1448_ver_3 11 KPCDSCKTTSASVFCRADSAFLCMSCDSKVHEA 43
                                         67******99*******************9965 PP

2zf-B_box25.82.2e-085395339
                             zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                                          ++C+ +e+ +++  C+ +   lC++C   +H+       H++
  cra_locus_6684_iso_6_len_1448_ver_3 53 VWVCEVCEQAPASVTCKADAAALCATCDRDIHSAnplarrHER 95
                                         689*****************************65777777776 PP

3CCT69.86.8e-24284327144
                                  CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                          Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  cra_locus_6684_iso_6_len_1448_ver_3 284 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 327
                                          9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.338855IPR000315B-box-type zinc finger
SMARTSM003363.9E-9855IPR000315B-box-type zinc finger
PfamPF006438.0E-61150IPR000315B-box-type zinc finger
CDDcd000212.86E-71255No hitNo description
PROSITE profilePS5011910.585198IPR000315B-box-type zinc finger
PfamPF006431.8E-65397IPR000315B-box-type zinc finger
CDDcd000212.32E-85498No hitNo description
SMARTSM003362.3E-105698IPR000315B-box-type zinc finger
PfamPF062035.2E-18284326IPR010402CCT domain
PROSITE profilePS5101716.787284326IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MGGESWSLTA KPCDSCKTTS ASVFCRADSA FLCMSCDSKV HEANKLASRH ARVWVCEVCE  60
QAPASVTCKA DAAALCATCD RDIHSANPLA RRHERFPVIP FYDSATAAKC SGTSADDTKC  120
LLDEAEEAEA ASWLLPTPNC NKDNADPETP EYKTADYLFK DMDPYLDIDL ISSDDQKPHI  180
FXXXXSSSSS SSFPQFPRSR SYQEPERHSP LQAPVVDGYP TYDMDYAAGS KPFMYNFTSQ  240
SISQSVSSSS MEVGVVPEHN PMADVSNSFS RNEGIPNPLT GIDREARVLR YREKRKNRKF  300
EKTIRYASRK AYAETRPRIK GRFAKRTEVE VESLMSVEEA SYGVVPTY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027084679.11e-171zinc finger protein CONSTANS-LIKE 4-like
RefseqXP_027183043.11e-171zinc finger protein CONSTANS-LIKE 4-like
SwissprotQ940T98e-95COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLA0A068V3I51e-170A0A068V3I5_COFCA; Uncharacterized protein
STRINGXP_009590370.11e-158(Nicotiana tomentosiformis)
STRINGXP_009618115.11e-158(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376