PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_6442_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family Dof
Protein Properties Length: 346aa    MW: 36580.9 Da    PI: 7.5284
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_6442_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.28.8e-3942101261
                               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                                          +++alkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+s
  cra_locus_6442_iso_2_len_1653_ver_3  42 NQQALKCPRCDSLNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGVLRNVPVGGGCRKTKRS 101
                                          6899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027012.8E-3344100IPR003851Zinc finger, Dof-type
ProDomPD0074784.0E-2744100IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.61846100IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104884IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MQDIHAIGGG GGGGAVAGGG GRLFASGTGG GDRRLRPHHN QNQQALKCPR CDSLNTKFCY  60
YNNYNLSQPR HFCKSCRRYW TKGGVLRNVP VGGGCRKTKR SKPKPTVSSD AAAAASAAAP  120
SMEHNSNSHS SSESSSLTAT TTAAKNTATT AGGSSGEVAS ATVNSSNTST NLLSFQNSAR  180
FFASPQQFNA SSSFDQQQQQ LIDPSVSSNG QMFQEIGSFT SLMTSSNDPS LLGYNVADVS  240
TYRLQQNHHA VDDRSSNQMM GSTGEDDLKM EPINCGFLDQ TAQIGFSGLH QGRMNNGGLG  300
GLDWQMNGGG GGDQGLFDFT GTVDQTYWGQ NQWGDNDQSL NFPPLV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002267092.16e-90PREDICTED: dof zinc finger protein DOF5.4
TrEMBLA0A068TRH11e-137A0A068TRH1_COFCA; Uncharacterized protein
STRINGVIT_17s0000g04850.t012e-83(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419