PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_62259_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family Dof
Protein Properties Length: 186aa    MW: 20936.7 Da    PI: 8.4825
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_62259_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof113.31e-352541062
                               zf-Dof 10 rCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                                         rC+stntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvPvGgg+rkn+k+s
  cra_locus_62259_iso_2_len_555_ver_3  2 RCNSTNTKFCYYNNYSLSQPRYFCKTCRRYWTAGGSLRNVPVGGGSRKNNKRS 54
                                         9************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088427.028152IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-20246IPR003851Zinc finger, Dof-type
PfamPF027011.2E-29252IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
XRCNSTNTKF CYYNNYSLSQ PRYFCKTCRR YWTAGGSLRN VPVGGGSRKN NKRSSSSINS  60
NPNSSSKKIC LPDPKIHHPH DLNLAYNPPD FINGQISQFF AFDPTNPNID LTTTTSTSSA  120
MELFKTAGNI MASDHFNPLN DHQFKPSLGF SLDGLEINGL QDHPSRIIFP FEDLKNSSIN  180
EFDHQX
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011075948.16e-52PREDICTED: dof zinc finger protein DOF4.6-like
TrEMBLA0A0S3REK81e-49A0A0S3REK8_PHAAN; Uncharacterized protein
TrEMBLV7ASA71e-49V7ASA7_PHAVU; Uncharacterized protein
STRINGVIT_16s0098g01420.t014e-46(Vitis vinifera)