PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_61901_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family NAC
Protein Properties Length: 122aa    MW: 13784.3 Da    PI: 10.6886
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_61901_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM102.17.7e-3227257128
                                  NAM  57 ewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                          ewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk++++ +g++vg+kk Lvfy g+apkg+kt+W+mheyrl
  cra_locus_61901_iso_1_len_363_ver_3   2 EWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKAITT-EGRKVGIKKALVFYIGKAPKGTKTNWIMHEYRL 72 
                                          8*************************************.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100541.994195IPR003441NAC domain
SuperFamilySSF1019412.09E-40296IPR003441NAC domain
PfamPF023652.1E-15372IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 122 aa     Download sequence    Send to blast
XEWYFFSPRD RKYPNGSRPN RVAGSGYWKA TGTDKAITTE GRKVGIKKAL VFYIGKAPKG  60
TKTNWIMHEY RLSEPSRKIG SSRLDDWVLC RIYKKNSSAQ KSNISDLQNK EISHGSSSSS  120
SS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A7e-64210175174NAC domain-containing protein 19
3swm_B7e-64210175174NAC domain-containing protein 19
3swm_C7e-64210175174NAC domain-containing protein 19
3swm_D7e-64210175174NAC domain-containing protein 19
3swp_A7e-64210175174NAC domain-containing protein 19
3swp_B7e-64210175174NAC domain-containing protein 19
3swp_C7e-64210175174NAC domain-containing protein 19
3swp_D7e-64210175174NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts downstream of MYC2 in the jasmonate-mediated response to Botrytis cinerea infection (PubMed:28733419). With MYC2 forms a transcription module that regulates wounding-responsive genes (PubMed:28733419). Involved in jasmonate- and coronatine-mediated stomatal reopening in response to Pseudomonas syringae pv tomato DC3000 infection (PubMed:25005917). Regulates the expression of threonine deaminase 2 (TD2) through promoter binding (PubMed:28733419). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by jasmonate (JA) (PubMed:25005917, PubMed:28733419, PubMed:30610166). Induced by wounding (PubMed:28733419, PubMed:25005917). Induced by infection with the fungal pathogen Botrytis cinerea (PubMed:28733419). Induced by coronatine (PubMed:25005917). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419, ECO:0000269|PubMed:30610166}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001306107.13e-71JA2-like
SwissprotA0A3Q7HH642e-72JA2L_SOLLC; NAC domain-containing protein JA2L
TrEMBLM1BP491e-68M1BP49_SOLTU; Uncharacterized protein
STRINGSolyc07g063410.2.11e-70(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31222452
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  2. Du M, et al.
    MYC2 Orchestrates a Hierarchical Transcriptional Cascade That Regulates Jasmonate-Mediated Plant Immunity in Tomato.
    Plant Cell, 2017. 29(8): p. 1883-1906
    [PMID:28733419]
  3. Liu Y, et al.
    MYC2 Regulates the Termination of Jasmonate Signaling via an Autoregulatory Negative Feedback Loop.
    Plant Cell, 2019. 31(1): p. 106-127
    [PMID:30610166]