PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_5886_iso_5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 431aa    MW: 47720.3 Da    PI: 7.2994
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_5886_iso_5genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1023.7e-32274329156
                              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                          k+r++W+peLH+rFv+a+++LGG + AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  cra_locus_5886_iso_5_len_1786_ver_3 274 KQRRCWSPELHRRFVDALQKLGGCQAATPKQIRELMQVDGLTNDEVKSHLQKYRLH 329
                                          79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.294271331IPR017930Myb domain
SuperFamilySSF466894.48E-18271332IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-29272332IPR009057Homeodomain-like
TIGRFAMsTIGR015579.4E-27274329IPR006447Myb domain, plants
PfamPF002492.6E-8276327IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 431 aa     Download sequence    Send to blast
MGSIPPEMSL DYRPTSTTAA TAAATAESSF PGTISKLIAQ VTTMGHVSER MLKLDDYVNR  60
LEDEMRKIEA FKRELPLCML LLSDAILALK EESDRYRKSN AEPVLEEFIP LKKSSDEDET  120
DKGEIRKEDC KDKMNWMSSV QLWNSDHQST KLDDNSSKQI PKPDSKKRLS EEENHGTSED  180
FFKSRKSHST VKAFAPFKGC SGLPLILPGK EDNEELPGVP GLSLKNLGIK KPREDFSCVG  240
FSSTAGGSRA VSSITSVQSN VRALSHSQSQ TARKQRRCWS PELHRRFVDA LQKLGGCQAA  300
TPKQIRELMQ VDGLTNDEVK SHLQKYRLHT RRLPTTRSST ANQSVVVLGG LWVPGEQHCE  360
SSKQSTSQSG SPECPFQLGG GASGGTSMTG GDSIEDEEDE KSESHSWRSH ALTSKTNNVX  420
QMFLPRPDLR I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-13274327255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-13274327255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A4e-13274327154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-13274327154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-13274327154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-13274327154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-13274327255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-13274327255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-13274327255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-13274327255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-13274327255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-13274327255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027112425.11e-172transcription factor HHO2-like
TrEMBLA0A068TME11e-167A0A068TME1_COFCA; Uncharacterized protein
STRINGVIT_03s0063g01060.t011e-141(Vitis vinifera)