PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_5886_iso_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 360aa    MW: 39963.1 Da    PI: 7.8389
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_5886_iso_3genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.42.9e-32203258156
                              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                          k+r++W+peLH+rFv+a+++LGG + AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  cra_locus_5886_iso_3_len_1369_ver_3 203 KQRRCWSPELHRRFVDALQKLGGCQAATPKQIRELMQVDGLTNDEVKSHLQKYRLH 258
                                          79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.294200260IPR017930Myb domain
SuperFamilySSF466892.82E-18200261IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-29201261IPR009057Homeodomain-like
TIGRFAMsTIGR015577.2E-27203258IPR006447Myb domain, plants
PfamPF002492.0E-8205256IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
XEMRKIEALL LSDAILALKE ESDRYRKSNA EPVLEEFIPL KKSSDEDETD KGEIRKEDCK  60
DKMNWMSSVQ LWNSDHQSTK LDDNSSKQIP KPDSKKRLSE EENHGTSEDF FKSRKSHSTV  120
KAFAPFKGCS GLPLILPGKE DNEELPGVPG LSLKNLGIKK PREDFSCVGF SSTAGGSRAV  180
SSITSVQSNV RALSHSQSQT ARKQRRCWSP ELHRRFVDAL QKLGGCQAAT PKQIRELMQV  240
DGLTNDEVKS HLQKYRLHTR RLPTTRSSTA NQSVVVLGGL WVPGEQHCES SKQSTSQSGS  300
PECPFQLGGG ASGGTSMTGG DSIEDEEDEK SESHSWRSHA LTSKTNNVXQ MFLPRPDLRI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A3e-13203256154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-13203256154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-13203256154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-13203256154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027112425.11e-137transcription factor HHO2-like
TrEMBLA0A068TME11e-131A0A068TME1_COFCA; Uncharacterized protein
STRINGXP_009774094.11e-113(Nicotiana sylvestris)