PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_57500_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 190aa    MW: 20825.8 Da    PI: 7.6046
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_57500_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1062.1e-3352107156
                              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                          k+r++W+peLH+rFv+a++qLGG+++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  cra_locus_57500_iso_1_len_599_ver_3  52 KQRRCWSPELHRRFVNALQQLGGAQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 107
                                          79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.08449109IPR017930Myb domain
SuperFamilySSF466893.81E-1949110IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.5E-3050110IPR009057Homeodomain-like
TIGRFAMsTIGR015578.3E-2852107IPR006447Myb domain, plants
PfamPF002492.7E-854105IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
DELPIVPGFS LCTPEINVSR EDINYNGFSS KSSTSRSGSS SATNGQSQTA RKQRRCWSPE  60
LHRRFVNALQ QLGGAQVATP KQIRELMQVD GLTNDEVKSH LQKYRLHTRK ASASTMNTST  120
VQHLGLWVSQ EQCGESSKPS NSQSGSPQGP LHLARSSRGT SMMTGGDSME DEDDEKTESH  180
SWKSDIQLSG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A6e-1452105154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-1452105154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-1452105154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-1452105154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phosphate signaling in roots. {ECO:0000250|UniProtKB:Q9FX67}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011092742.17e-80myb family transcription factor EFM
SwissprotQ9FX841e-41HHO6_ARATH; Transcription factor HHO6
TrEMBLA0A067L2E94e-68A0A067L2E9_JATCU; Uncharacterized protein
STRINGcassava4.1_009052m5e-67(Manihot esculenta)
STRINGXP_002521841.16e-67(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43612443
Publications ? help Back to Top
  1. Nagarajan VK,Satheesh V,Poling MD,Raghothama KG,Jain A
    Arabidopsis MYB-Related HHO2 Exerts a Regulatory Influence on a Subset of Root Traits and Genes Governing Phosphate Homeostasis.
    Plant Cell Physiol., 2016. 57(6): p. 1142-52
    [PMID:27016098]