PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_5160_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 88aa    MW: 10395.1 Da    PI: 10.4189
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_5160_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.49e-151461148
                                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                        +g+W++eEd +l  ++ ++G  +W+  ++  g+ R++k+c++rw++yl
  cra_locus_5160_iso_1_len_411_ver_3 14 KGAWSEEEDNKLRAYILRYGHWNWRQLPKFAGLARCGKSCRLRWLNYL 61
                                        79******************99*************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.1E-22664IPR009057Homeodomain-like
PROSITE profilePS5129421.691965IPR017930Myb domain
SMARTSM007171.3E-91363IPR001005SANT/Myb domain
PfamPF002491.5E-131461IPR001005SANT/Myb domain
SuperFamilySSF466893.43E-221588IPR009057Homeodomain-like
CDDcd001677.51E-81661No hitNo description
Gene3DG3DSA:1.10.10.601.3E-96588IPR009057Homeodomain-like
PROSITE profilePS512949.5056688IPR017930Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 88 aa     Download sequence    Send to blast
MVRSPSIDKN GLRKGAWSEE EDNKLRAYIL RYGHWNWRQL PKFAGLARCG KSCRLRWLNY  60
LKPGLKRGPI TEEEEEMIVK LHEKLGNK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-13128825100MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011091328.13e-47PREDICTED: myb-related protein Myb4-like
SwissprotP813931e-34MYB08_ANTMA; Myb-related protein 308
SwissprotP813944e-34MYB15_ANTMA; Myb-related protein 315
TrEMBLA0A068UTL81e-50A0A068UTL8_COFCA; Uncharacterized protein
STRINGPOPTR_0013s14550.12e-44(Populus trichocarpa)