PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_47931_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 141aa    MW: 16744.3 Da    PI: 9.5171
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_47931_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like962.9e-30558255
                              G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                         +r+rWt+eLH++F+e v+ LGG++kAtPk il+lmk +gLt+ h+kSHLQkYR+
  cra_locus_47931_iso_2_len_596_ver_3  5 KRMRWTQELHNQFLESVRLLGGPKKATPKGILKLMKCEGLTIFHIKSHLQKYRV 58
                                         7****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.898161IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.8E-27259IPR009057Homeodomain-like
SuperFamilySSF466897.7E-17359IPR009057Homeodomain-like
TIGRFAMsTIGR015573.6E-24559IPR006447Myb domain, plants
PfamPF002491.1E-8657IPR001005SANT/Myb domain
PfamPF143791.2E-1588130IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 141 aa     Download sequence    Send to blast
MEKRKRMRWT QELHNQFLES VRLLGGPKKA TPKGILKLMK CEGLTIFHIK SHLQKYRVTQ  60
YVPESKQEDN TENTQRSSIT ELDQEMSMQI VEALKMQIDV QKRLYEQLQC QKNLQSRIEE  120
QAQQLKKMFD CRVETNTENA S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A9e-25461158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B9e-25461158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C9e-25461158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D9e-25461158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022896540.14e-51myb family transcription factor PHL5-like
SwissprotQ9SJW09e-44PHL7_ARATH; Myb family transcription factor PHL7
TrEMBLA0A1U8ASR36e-48A0A1U8ASR3_NELNU; myb family transcription factor PHL5-like
STRINGXP_010265860.11e-48(Nelumbo nucifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1671745