PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_4511_iso_7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 1150aa    MW: 130159 Da    PI: 8.0983
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_4511_iso_7genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.51.3e-32927981155
                              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                          kpr+rWtpeLHe Fveav++LGGse+AtPk +l+lm+ +gLt++hvkSHLQkYR+
  cra_locus_4511_iso_7_len_3718_ver_3 927 KPRMRWTPELHEIFVEAVNKLGGSERATPKGVLKLMNKEGLTIYHVKSHLQKYRT 981
                                          79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF130411.5E-103076IPR002885Pentatricopeptide repeat
PROSITE profilePS5137511.3343165IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007564.4E-43366IPR002885Pentatricopeptide repeat
PROSITE profilePS5137511.12666100IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007563.2E-668102IPR002885Pentatricopeptide repeat
Gene3DG3DSA:1.25.40.107.9E-1384373IPR011990Tetratricopeptide-like helical domain
PfamPF130411.7E-16100149IPR002885Pentatricopeptide repeat
PROSITE profilePS5137512.025101135IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007561.6E-7104136IPR002885Pentatricopeptide repeat
PROSITE profilePS5137512.573136170IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007566.1E-8139170IPR002885Pentatricopeptide repeat
PfamPF130419.0E-15170218IPR002885Pentatricopeptide repeat
PROSITE profilePS5137513.263171205IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007561.1E-10173207IPR002885Pentatricopeptide repeat
SuperFamilySSF819011.28E-8184406No hitNo description
PROSITE profilePS5137511.192206240IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007565.2E-7208241IPR002885Pentatricopeptide repeat
PROSITE profilePS513759.997241275IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007562.7E-4243276IPR002885Pentatricopeptide repeat
PfamPF015350.0011243273IPR002885Pentatricopeptide repeat
PfamPF130412.3E-15276324IPR002885Pentatricopeptide repeat
PROSITE profilePS5137511.356276310IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007564.9E-6279311IPR002885Pentatricopeptide repeat
PROSITE profilePS513759.043311345IPR002885Pentatricopeptide repeat
PfamPF130412.8E-9346390IPR002885Pentatricopeptide repeat
PROSITE profilePS5137510.205346376IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007565.2E-6349376IPR002885Pentatricopeptide repeat
PROSITE profilePS513759.405377411IPR002885Pentatricopeptide repeat
PROSITE profilePS5129410.427924984IPR017930Myb domain
SuperFamilySSF466895.91E-17924981IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-29926983IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-23927981IPR006447Myb domain, plants
PfamPF002492.0E-10929980IPR001005SANT/Myb domain
PfamPF143791.1E-2210121058IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1150 aa     Download sequence    Send to blast
RKQQNHIFRV RRLNEAEAVL IDAIRVGVLP DVITYNTLIN GYCRFLGIDA GCSVLGRMRE  60
AGIWPNVITY NTLLYAASRY RLLSRSLDLF EEMLQAGICP DVWSYNTLIH CFFKLGKSDE  120
AYRVFKDLVL RNISPSPATF NTMLNGLCKN GYIDNALMFF RNLQRNGFVP EVVTYNILID  180
GLCKSKRWRT AKRLLKEMEE LGYYPNAITY TTAMKCCFKS GRLEEGLHIF SEMKALGYTF  240
DAFSYCTVIG ALLKAGRTME AHECMECMLR SGIEIDIVFY NNLINLYCKE GKFEEAFHLI  300
EQAENYGLKC DQYTHTILID GLCKSFNLEV AQKHLKYMSR AGFDSNVVAL NCFINGLCRL  360
GQFDYAMQVF QSMKNKDGFT YSCLVHGLCR FGKFHAAAEL LLSSIRGGMK FLPSDKRVVI  420
SGLRSQGGFK DAKKLKSKIK MAELLQYXFX EQXFISSFLE GIWFKKFLDM GCRYSSPVFK  480
FQLIKNGQLI FKEQLGRRXP FFLLVMGNKI QKNDMFWKLD RKISGGSIPP VNVFVLKELE  540
TGQIFKIXFV YQNIIKDHFR AQLRIRVSEI EFSGYCNIMG EKPLXXRHHN LGDNIPSGLA  600
KGYXVYMIQA LDLVRFRMIQ VIDXVAEXLT DSISLAKETI SSFPLNSQQS VSSQPLQEAF  660
RFVVDGKKWT RNLHYLFGEX NEATLSNMGA SGATSTSLPN LPSPLAEKYP KLPDSLQVTS  720
EPELTTNSLS SLPAPLSSRS ETVGHQFSST SGFPKDLKYP SFSSQNGRSQ NYPFLSQSRT  780
EEASLETGPF AGVQSKQLNS CHLGNNNIPW STEAVQDFPD FSRNIPVQND QVESLSGVMV  840
SEDHVKKNDW HDWADQLISV DDPIDSNWSD LLVDVNVPDP DSKLLQLSPV LPVLEPQPQS  900
QPHNQNPLPS GQICPVSSPS SAATLAKPRM RWTPELHEIF VEAVNKLGGS ERATPKGVLK  960
LMNKEGLTIY HVKSHLQKYR TARYKPEPSE GTSEKKSNTV AEMTSLDFKT TMGITEALRL  1020
QMEVQKQLHE QLEIQRNLQL RIEEQGKYIQ MMFEKHRKME EDKSKTPGPS SDEPSLSPAK  1080
TDSKINEQSE SKEQDKSAKE SSSSDACPRE KYTEESPSKE QKTPERKSCE DQDQDGSVPP  1140
AKRAKAGESL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5i9f_A2e-95544415444pentatricopeptide repeat protein dPPR-U10
5i9h_A2e-95544415444pentatricopeptide repeat protein dPPR-U8G2