PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_4511_iso_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 482aa    MW: 53448.4 Da    PI: 5.1882
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_4511_iso_3genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1054.3e-33259313155
                              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                          kpr+rWtpeLHe Fveav++LGGse+AtPk +l+lm+ +gLt++hvkSHLQkYR+
  cra_locus_4511_iso_3_len_2085_ver_3 259 KPRMRWTPELHEIFVEAVNKLGGSERATPKGVLKLMNKEGLTIYHVKSHLQKYRT 313
                                          79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-17256313IPR009057Homeodomain-like
PROSITE profilePS5129410.427256316IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-30258315IPR009057Homeodomain-like
TIGRFAMsTIGR015573.3E-24259313IPR006447Myb domain, plants
PfamPF002496.8E-11261312IPR001005SANT/Myb domain
PfamPF143793.7E-23344390IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 482 aa     Download sequence    Send to blast
MDAQSSLFIR RTNEATLSNM GASGATSTSL PNLPSPLAEK YPKLPDSLQV TSEPELTTNS  60
LSSLPAPLSS RSETVGHQFS STSGFPKDLK YPSFSSQNGR SQNYPFLSQS RTEEASLETG  120
PFAGVQSKQL NSCHLGNNNI PWSTEAVQDF PDFSRNIPVQ NDQVESLSGV MVSEDHVKKN  180
DWHDWADQLI SVDDPIDSNW SDLLVDVNVP DPDSKLLQLS PVLPVLEPQP QSQPHNQNPL  240
PSGQICPVSS PSSAATLAKP RMRWTPELHE IFVEAVNKLG GSERATPKGV LKLMNKEGLT  300
IYHVKSHLQK YRTARYKPEP SEGTSEKKSN TVAEMTSLDF KTTMGITEAL RLQMEVQKQL  360
HEQLEIQRNL QLRIEEQGKY IQMMFEKHRK MEEDKSKTPG PSSDEPSLSP AKTDSKINEQ  420
SESKEQDKSA KESSSSDACP REKYTEESPS KEQKTPERKS CEDQDQDGSV PPAKRAKAGE  480
SL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-29258317160Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-29258317160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-29258317160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-29258317160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-29258317160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-29258317160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-29258317160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-29258317160Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as central integrator of phosphate starvation responses (PubMed:20838596). Regulates FER1 expression upon phosphate starvation, linking iron and phosphate homeostasis (PubMed:23788639). {ECO:0000269|PubMed:20838596, ECO:0000269|PubMed:23788639}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not up-regulated by Pi starvation. {ECO:0000269|PubMed:26586833}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027088350.10.0protein PHR1-LIKE 1-like isoform X2
SwissprotQ8GUN51e-95PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A068U7Z00.0A0A068U7Z0_COFCA; Uncharacterized protein
STRINGXP_009775047.11e-156(Nicotiana sylvestris)
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Bonnot C, et al.
    A chemical genetic strategy identify the PHOSTIN, a synthetic molecule that triggers phosphate starvation responses in Arabidopsis thaliana.
    New Phytol., 2016. 209(1): p. 161-76
    [PMID:26243630]
  4. Aleksza D,Horváth GV,Sándor G,Szabados L
    Proline Accumulation Is Regulated by Transcription Factors Associated with Phosphate Starvation.
    Plant Physiol., 2017. 175(1): p. 555-567
    [PMID:28765275]