PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_3966_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family HSF
Protein Properties Length: 211aa    MW: 23332.7 Da    PI: 4.4873
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_3966_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind57.44.1e-182675251
                                         HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HH CS
                         HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfa 51
                                         Fl+k+y++++d++++++isw+++g++f+v++++efa+++LpkyFkh+n+ 
  cra_locus_3966_iso_1_len_1080_ver_3 26 FLTKTYQLVDDPTIDDIISWNDDGSAFIVWNPTEFARDLLPKYFKHNNIY 75
                                         9***********************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.101.2E-182074IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004152.5E-1222144IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467852.09E-162374IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004472.3E-142675IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.7E-102649IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.7E-106476IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MPPSPAERNG GESTVGDAPR SLPTPFLTKT YQLVDDPTID DIISWNDDGS AFIVWNPTEF  60
ARDLLPKYFK HNNIYVLMSS YAGNNNNNNN SSSGGGNNDQ SAESSQVMKA LDLLPASRSR  120
LCEEMMNTDD GGGGEDRMDL DARLFGVAIG MKRARQNERA MADDYRELQL QQPGTEVKSE  180
PLDQLNGGNS QKTSWCNKQC QRQNSISRVC M
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009603015.14e-38PREDICTED: heat stress transcription factor B-2b
RefseqXP_009603016.14e-38PREDICTED: heat stress transcription factor B-2b
RefseqXP_009603017.14e-38PREDICTED: heat stress transcription factor B-2b
RefseqXP_016505355.14e-38PREDICTED: heat stress transcription factor B-2b-like
RefseqXP_016505356.14e-38PREDICTED: heat stress transcription factor B-2b-like
STRINGSolyc03g026020.2.13e-36(Solanum lycopersicum)