PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_35960_iso_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family ARF
Protein Properties Length: 608aa    MW: 67876.1 Da    PI: 7.0524
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_35960_iso_3genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B373.52.6e-2372172198
                                           EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHH CS
                                    B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWk 66 
                                           f+k+lt sd++++g +++ +k+a+e+       + +   s++l+ +d++g +W++k+i+r++++r++lt+GW+
  cra_locus_35960_iso_3_len_1822_ver_3  72 FCKILTASDTSTHGGFSVLRKHATEClpqldmtQAI--PSQDLVAKDLHGYEWRFKHIFRGQPRRHLLTTGWS 142
                                           99**************************99865444..4569******************************* PP

                                           HHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
                                    B3  67 eFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                                            Fv +++L +gD +vF   + +++el+v+v+r
  cra_locus_35960_iso_3_len_1822_ver_3 143 TFVTSKRLVAGDAFVFL--RGDDGELRVGVRR 172
                                           *****************..3489999****98 PP

2Auxin_resp103.62.4e-34198277183
                            Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvr 73 
                                           a+ha++t++ F v+Y+Pr+  s+F++ ++k+++a+k+ +svGmRfkm+fe+eds+err++Gt+vgv d++p +
  cra_locus_35960_iso_3_len_1822_ver_3 198 ASHAITTHTLFVVYYKPRT--SQFIIGLNKYLEAVKHGFSVGMRFKMKFEGEDSPERRFTGTIVGVGDVSP-Q 267
                                           789***************6..9*************************************************.* PP

                            Auxin_resp  74 WpnSkWrsLk 83 
                                           W++S+WrsLk
  cra_locus_35960_iso_3_len_1822_ver_3 268 WSDSRWRSLK 277
                                           ********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.109.0E-3964187IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.57E-3864201IPR015300DNA-binding pseudobarrel domain
CDDcd100173.03E-2071172No hitNo description
PfamPF023622.9E-2172172IPR003340B3 DNA binding domain
SMARTSM010192.9E-2072174IPR003340B3 DNA binding domain
PROSITE profilePS5086311.91472174IPR003340B3 DNA binding domain
PfamPF065077.7E-32198277IPR010525Auxin response factor
PfamPF023092.7E-7501554IPR033389AUX/IAA domain
SuperFamilySSF542773.29E-14511594No hitNo description
PROSITE profilePS5174527.202518599IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2409.0E-4521590No hitNo description
PfamPF023091.3E-5564602IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 608 aa     Download sequence    Send to blast
XASMNQELNQ QIPQFNLHSK ILCRVVHIRL LAEAETDEVY AQITLHPEED QNEPTSPDPC  60
PPDQPKRTVQ SFCKILTASD TSTHGGFSVL RKHATECLPQ LDMTQAIPSQ DLVAKDLHGY  120
EWRFKHIFRG QPRRHLLTTG WSTFVTSKRL VAGDAFVFLR GDDGELRVGV RRLARQQSSI  180
PPSVISSQSM HLGVLATASH AITTHTLFVV YYKPRTSQFI IGLNKYLEAV KHGFSVGMRF  240
KMKFEGEDSP ERRFTGTIVG VGDVSPQWSD SRWRSLKIQW DEPTTIKRPE RVSPWEIEPF  300
EATSSVDISQ SMTKSKRPRS LDVPVSENNS IHAAAPFWCP APPASRELNN LDGAEVQNNE  360
NKTFWAPNQK DLNSSSSGSI MRPGGVWPGQ LRKGSLDLFR DPAEDLSARS IVSDYYSPVS  420
SKASNGPVLD QVEKGKRHEN VLGCRLFGID LWNNSNDSSL EKGAPSTEIV ADHANNASAS  480
AGKCDQDLLK SCKDKKQVQS DSSPNDGQNK QSFSASTRTR TKVQMQGVAV GRAVDLTSLG  540
SYDDLISELE KLFELKGELR PRNKWEVVYT DDEGDMMLVG DDPWLEFCKM ARKIFIYSSE  600
EVKKMSAG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-149230454359Auxin response factor 1
4ldw_A1e-149230454359Auxin response factor 1
4ldw_B1e-149230454359Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027115457.10.0auxin response factor 11
SwissprotQ9C5W90.0ARFR_ARATH; Auxin response factor 18
TrEMBLA0A068UK570.0A0A068UK57_COFCA; Auxin response factor
STRINGPGSC0003DMT4000003450.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23472450
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Wójcikowska B,Gaj MD
    Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis.
    Plant Cell Rep., 2017. 36(6): p. 843-858
    [PMID:28255787]