PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_35394_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family Dof
Protein Properties Length: 337aa    MW: 36384.4 Da    PI: 9.0686
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_35394_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.24.2e-3964123362
                                zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                           e+alkcprC+stntkfCy+nnyslsqPr+fCk+CrryWt+GGalrnvPvGgg+r+nk+++
  cra_locus_35394_iso_1_len_1163_ver_3  64 ETALKCPRCESTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKRTK 123
                                           7789*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3547116IPR003851Zinc finger, Dof-type
PfamPF027011.2E-3266121IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.60967121IPR003851Zinc finger, Dof-type
PROSITE patternPS01361069105IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
QQFPNHHHEL ITTTSQPSLP PPVPPPLPPP PPPVAQSHHG GLSGSIRPGS MSERARLANV  60
PMPETALKCP RCESTNTKFC YFNNYSLSQP RHFCKTCRRY WTRGGALRNV PVGGGCRRNK  120
RTKSTSSNNN SPVSSSDRQT NNSSNSTNSS TVSSTSVQIP PLGFLSPLSQ LTSHDHHFSA  180
SDINLNNYGG ISTPVTSEMN FQLGTNFLGI NSNVGVGVGI DQQWRLPQAQ QFPFLGGLDL  240
SSSALYGQLQ GSIEPSSFVG ETSHQVRPKL LSSAILTQLA SVKMEEHNQD QMNLSRQLMM  300
GIPGNDTNNL QWNSGSSVAA AWTDLSSFSS SSTSNPL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00407DAPTransfer from AT3G55370Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007027045.12e-96DNA binding with one finger 2.4, putative
TrEMBLA0A068UG681e-116A0A068UG68_COFCA; Uncharacterized protein
STRINGVIT_08s0007g00180.t017e-91(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA19172463