PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_34408_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family GATA
Protein Properties Length: 158aa    MW: 17648.7 Da    PI: 10.3077
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_34408_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.83e-185185135
                                 GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                                         C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  cra_locus_34408_iso_1_len_579_ver_3 51 CLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRL 85
                                         99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.7434581IPR000679Zinc finger, GATA-type
SMARTSM004017.3E-184595IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.47E-1646109No hitNo description
Gene3DG3DSA:3.30.50.101.0E-144983IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.66E-135097No hitNo description
PfamPF003203.9E-165185IPR000679Zinc finger, GATA-type
PROSITE patternPS0034405176IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
XITPSVSSSS ESDITTSSGK KTGKATLKKK EAAENGAGNN MVANNSEGRK CLHCATDKTP  60
QWRTGPMGPK TLCNACGVRY KSGRLVPEYR PAASPTFVLT KHSNSHRKVL ELRRQKEMLR  120
AQQHQQQFLH QNMMFDHVSN GDDYLIHQHI GPDFRQLI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010267189.17e-80PREDICTED: GATA transcription factor 12-like
SwissprotP697811e-62GAT12_ARATH; GATA transcription factor 12
TrEMBLA0A103XZQ01e-77A0A103XZQ0_CYNCS; Transcription factor, GATA, plant
STRINGPGSC0003DMT4000749355e-76(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA19192363