PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_3317_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 385aa    MW: 43983.4 Da    PI: 10.0121
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_3317_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.74e-3198151255
                              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                          prlrWtp+LH +Fv+a+e+LGG+e+AtPk +l+lm+v gL+++hvkSHLQ+YR+
  cra_locus_3317_iso_2_len_1655_ver_3  98 PRLRWTPDLHLSFVHAIERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRS 151
                                          8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-2894152IPR009057Homeodomain-like
PROSITE profilePS5129411.52394154IPR017930Myb domain
SuperFamilySSF466894.48E-1497152IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-2298152IPR006447Myb domain, plants
PfamPF002493.6E-899150IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
METMMMPSVI SQKSEMSMEA PAESNDSQIN VSSIDLNEEL SSSQLEDEET ASSGCEKSSR  60
ELGNSENTTT SYNTKYSGLD HQRKNEKKVR QYIRSKLPRL RWTPDLHLSF VHAIERLGGQ  120
ERATPKLVLQ LMNVRGLSIA HVKSHLQMYR SKRLDESGQV LGRANRGVFQ AGKGYNIPDK  180
MGNPLLLQHN LRFHNLITSH HHSLHQSPYY IRSLSSRYQQ WHPYGKDTTI KARALMSMDN  240
NQHGNNRSWV NYGMHGAGST RNINGPIRPS RLHEEKRWPP PRERIMISKL ENAPAVSRPC  300
SNQLGNNSVG TNYLKQRYNN YWKCSSSRDS CFKPSNFIPN HLLQQKNDDK VLDGKDWRLP  360
DDLQLSLRPS TKGDSDVNTM LSLSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A6e-1899153357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-1899153357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-1899153357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-1899153357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027105537.11e-87transcription factor HHO1-like
TrEMBLA0A068TN774e-86A0A068TN77_COFCA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA55162334