PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_3219_iso_5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 317aa    MW: 34695.3 Da    PI: 9.1722
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_3219_iso_5genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.53.5e-143377147
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                         r +WT+eE++++++a +++  + Wk+I   +g  +t  q++s+ qky
  cra_locus_3219_iso_5_len_1702_ver_3 33 RESWTEEEHDKFLEALQLFDRD-WKKIEDFVG-SKTVIQIRSHAQKY 77
                                         789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.35E-172783IPR009057Homeodomain-like
PROSITE profilePS5129416.2912882IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.0E-73183IPR009057Homeodomain-like
TIGRFAMsTIGR015579.8E-193180IPR006447Myb domain, plants
SMARTSM007171.1E-113280IPR001005SANT/Myb domain
PfamPF002497.8E-123377IPR001005SANT/Myb domain
CDDcd001672.67E-93578No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0032922Biological Processcircadian regulation of gene expression
GO:0043966Biological Processhistone H3 acetylation
GO:0046686Biological Processresponse to cadmium ion
GO:0048573Biological Processphotoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MANSVAASDG SGSTSGSGSG KKVRKPYTIT KSRESWTEEE HDKFLEALQL FDRDWKKIED  60
FVGSKTVIQI RSHAQKYFLK VQKNGTIAHV PPPRPKRKAA HPYPQKAPKN GLSXAEMINF  120
LEKRKEKCSI VVMKIWNPDL LLVFNLLSVL APAQASIGYP SAVNSLAPGY PTWDDASLLV  180
SVPPSGILPS QDEYNLHGAE ADIGSKGATR ISNSNISGIG SSSRTLPASE VPKQGKQGSL  240
VHGIPDFAEV YSFIGSVFDP ETKGHVQKLK EMDPINFETV LLLMRNLTVN LANPDFEPIK  300
QVLSSYDAKQ PSYELPC
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00338DAPTransfer from AT3G09600Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015089059.11e-150PREDICTED: protein REVEILLE 8-like
SwissprotQ8RWU31e-128RVE8_ARATH; Protein REVEILLE 8
TrEMBLA1DR841e-179A1DR84_CATRO; MYB transcription factor
STRINGSolyc10g084370.1.11e-149(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9982478